Browse

ftp://ftp.cse.ucsc.edu (713)

	ftp://ftp.cse.ucsc.edu//pub/item/tr88-29.ps.gz, 19910809 References 19 Kenneth J. Supowit and Steven J. Friedman. A new method for verifying sequential circuits. In ACM IEEE 23rd Design Automation Conference Proceedings, pages 20007, Las Vegas, NV, 29 June July 1986. 18 References Robert K. Brayton, Gary D. Hachtel, Curtis T. McMullen, and
	ftp://ftp.cse.ucsc.edu//pub/item/tr88-28.ps.gz, 19910809 References 21 Michael R. Garey and David S. Johnson. Computers and Intractability, A Guide to the Theory of NP-Completeness. W. H. Freeman and Company, San Francisco, CA, 1979. Kevin Karplus. Exclusion constraints, a new application of graph algorithms to VLSI design. In 4th MIT
	ftp://ftp.cse.ucsc.edu//pub/item/tr90-43.ps.gz, 19910809 References 17 Xmap (including merge) Amap XAmap subsets name f = 2 f = 3 f = 4 f = 5 10bitreg 0.78 0.83 0.82 0.83 0.75 1.13 XT 10count 1.38 1.23 1.25 1.18 1.18 1.70 XT 180degc 1.68 1.40 1.35 1.35 1.23 1.80 XT 3to8dmux 1.52 1.37 1.38 1.32 1.17 1.78 XT 4-16dec 0.88 0.85 0.85 0.92 0.83 1.25 XT 4cnt 1.03
	ftp://ftp.cse.ucsc.edu//pub/tcos/cfp/wmrd-2.ps.Z, 19920116 General Chair: Jehan-Franc,ois Pa ris Dept. of Computer Science University of Houston Houston, TX 77204-3475 (713) 749-3943 Internet: paris@cs.uh.edu Program Chair: Hector Garcia-Molina Dept. of Computer Science Stanford University Stanford, CA 94305 (415) 723-0685 Internet: hector@cs.stanford.edu
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n1/shapiro.ps.Z, 19920118 Object-Support Operating Systems Position paper for the Workshop on Operating Systems and Object Orientation at ECOOP{OOPSLA 1990 Marc Shapiro INRIA, BP 105, 78153 Rocquencourt C edex, France e-mail: shapiro@sor.inria.fr July 1990 1 Introduction The SOR group of INRIA (Syst emes a Objets R
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n2/guide.ps.Z, 19920118 Guide (Grenoble Universities Integrated Distributed Environment) Bull-IMAG Personnel Principal investigators Roland Balter (Bull) balter@imag.fr Sacha Krakowiak (IMAG) krakowiak@imag.fr Faculty and researchers D. Decouchant decouchant@imag.fr A. Duda duda@imag.fr C. Roisin roisin@imag.fr X. Rousset de
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n4/numatic.ps.Z, 19920118 NUMAtic Project and the DUnX OS Department of Computer Science Duke University Personnel Principal investigators Carla Ellis carla@cs.duke.edu Mark Holliday holliday@cs.duke.edu Other contributors Rick LaRowe rlarowe@encore.com David Kotz dfk@cs.duke.edu Students Vick Khera khera@cs.duke.edu Steve Owen
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n2/birlix.ps.Z, 19920118 BirliX (Birlinghoven Operating System) German National Research Center for Computer Science (GMD) Personnel Principal Investigators Hermann H artig haertig@gmdzi.gmd.de Winfried K uhnhauser kuehnhsr@gmdzi.gmd.de Researchers Oliver C. Kowalski kow@gmdzi.gmd.de Hermann Streich str@gmdzi.gmd.de Wolfgang
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n1/russo.ps.Z, 19920118 Object-Oriented Operating System Design Vincent F. Russo Purdue University Department of Computer Science West Lafayette, IN 47907 (USA) Phone: +1 (317) 494-6008 Fax: +1 (317) 494-0739 Email: russo@cs.purdue.edu 1 Introduction Operating system software should be designed and implemented to allow it to
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n1/vinny.ps.Z, 19920118 OISIN: Operating System Support for Objects in a Distributed Environment Vinny Cahill and Andre Kramer Distributed Systems Group, Department of Computer Science, Trinity College, University of Dublin Dublin 2, Ireland. 1 Introduction As part of the Esprit-I COMANDOS project the distributed systems group
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n3/maruti.ps.Z, 19920118 The MARUTI System and its Implementation Daniel Moss e, Olafur Gudmundsson, Ashok K. Agrawala Systems Design and Analysis Group Department of Computer Science University of Maryland College Park, MD 20742 fmosse, ogud, agrawalag@cs.umd.edu
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n1/chase.ps.Z, 19920118 Implementing Shared Data Objects Above the Kernel Jeff Chase, Sabine Habert, and Hank Levy Department of Computer Science and Engineering University of Washington Seattle, WA 98195 Commonly-cited goals for kernel-supported object abstractions are: (1) a uniform view of system resources, and (2) a common
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n4/arjuna.ps.Z, 19920118 Arjuna Computing Laboratory University of Newcastle upon Tyne Newcastle upon Tyne, Tyne and Wear NE1 7RU England Personnel Principal investigator Prof. Santosh K. Shrivastava Santosh.Shrivastava@newcastle.ac.uk Project members Dr. Graham D. Parrington Graham.Parrington@newcastle.ac.uk Dr. Stuart M.
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n3/prospero.ps.Z, 19920118 The Prospero Distributed Operating System Department of Computer Science and Engineering University of Washington Personnel and Contact B. Clifford Neuman University of Southern California Information Sciences Institute 4676 Admiralty Way Marina del Rey, California 90292 +1 (213) 822-1511 bcn@isi.edu
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n1/druschel.ps.Z, 19920118 representation \| again a source of inefficiency. We stress the efficiency and flexibility of the communications services provided by Lipto. Our design makes no assumptions about the size, homogeneity and the kinds of protocols used in the underlying network, nor do we assume that all the nodes in this
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n1/gourhant.ps.Z, 19920118 Fragmented Object: a Building Block for Distributed Object-Support Operating Systems Yvon Gourhant and Mesaac Mounchili Makpangou INRIA, B.P. 105, 78153 Le Chesnay C edex, France 1 Introduction The object oriented programming paradigm is increasingly recognized to be of primary importance in structuring
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n4/munin.ps.Z, 19920118 Munin: Distributed Shared Memory Using Multi-Protocol Release Consistency Department of Computer Science Rice University Personnel Principal investigator Willy Zwaenepoel willy@rice.edu Faculty John K. Bennett jkb@rice.edu Students John B. Carter retrac@rice.edu Pete Keleher pete@rice.edu
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n2/schwartz.ps.Z, 19920118 The Networked Resource Discovery Project Department of Computer Science University of Colorado, Boulder Personnel Principal investigator Michael F. Schwartz schwartz@latour.colorado.edu Students Sean Coleman coleman@bldrdoc.gov Nari Kannan kannan@strike.enet.dec.com Barbara League
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n4/symunix.ps.Z, 19920118 Symunix-2 (Highly Parallel Operating System) NYU Ultracomputer Project Ultracomputer Research Laboratory New York University Personnel Principal investigator Allan Gottlieb gottlieb@nyu.edu Researchers Jan Edler edler@nyu.edu Eric Freudenthal freudent@nyu.edu David Wood wood@nyu.edu Jim Lipkis
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n2/melampus.ps.Z, 19920118 Melampus IBM Almaden Research Center Personnel Luis-Felipe Cabrera cabrera@ibm.com Laura M. Haas laura@ibm.com Allen W. Luniewski luniew@ibm.com Joel E. Richardson joelr@ibm.com Peter M. Schwarz schwarz@ibm.com Jim W. Stamos stamos@ibm.com Contact Luis-Felipe Cabrera Computer Science Department Mail
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n1/rich.ps.Z, 19920118 Object Orientation in the Clouds Operating System Richard J. LeBlanc, Jr. College of Computing Georgia Tech Atlanta, GA 30332-0280 The Clouds distributed operating system provides kernel-level support for large-grained objects. The system provides a global name space, so object operations can be invoked
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n3/ficus.ps.Z, 19920118 The Ficus Scalable File System Ficus Project Computer Science Department University of California Los Angeles Personnel Principal investigators Gerald Popek Thomas Page Research staff Richard Guy Dieter Rothmeier Wai Mak Students John Heidemann Yuguang Wu Contacts Dr. Thomas Page Dr. Richard Guy
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n2/sor.ps.Z, 19920118 Syst emes d'Objets R epartis (Distributed Object-Support Systems) INRIA (Institut National de Recherche en Informatique et Automatique) Personnel Principal Investigator Marc Shapiro shapiro@sor.inria.fr Senior Researcher Mesaac Makpangou mak@sor.inria.fr Graduate Students Pierre Collet
	ftp://ftp.cse.ucsc.edu//pub/tcos/v5n4/arcade.ps.Z, 19920118 ARCADE Personal Computer Laboratory Department of Computer Science and Engineering University of Notre Dame Personnel Principal Investigator David Cohn dlc@cse.nd.edu Researchers Bill Delaney wpd@ece.arizona.edu Karen Tracey kmt@cse.nd.edu Students Michael Casey mrc@cse.nd.edu Paul Greenawalt
	ftp://ftp.cse.ucsc.edu//pub/tcos/cfp/iwoos.ps, 19920206 ..General ChairProgram ChairProgram CommitteeEric Jul Dept. of Computer Science, U. of Copenhagen, Universitetsparken 1 DK-2100 Copenhagen Denmark. roy@cs.uiuc.edueric@diku.dkLuis-Felipe Cabrera, IBM Reinhold Kroeger, GMD Rodger Lea, Chorus Systems Hank Levy, U. of Washington Jose Marques, INESC Larry
	ftp://ftp.cse.ucsc.edu//pub/item/euroasic.ps.gz, 19920312 original files optimized file xcmap xmap xtmap cpu xcmap xmap xtmap cpu 5xp1 66:5 60:9 63:5 20.7 21:3 19:3 18:3 9.0 9sym 193:23 127:37 152:23 44.2 8:3 8:3 8:3 55.4 9symml 62:5 56:7 58:5 12.2 8:3 8:3 8:3 9.1 C499 100:5 72:6 68:5 43.8 94:4 75:6 78:4 638.9 C880 156:8 102:12 140:8 98.4 170:7 118:12 170:7
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/cover.PS, 19920420 Application for Admission Division of Graduate Studies and Research 399 Applied Sciences University of California Santa Cruz, California 95064 408/459-2301 __________________________________________________________________________________________ INFORMATION AND FILING INSTRUCTIONS Please check the fact
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/lr.PS, 19920420 Recommendation for Admission Please return to: Division of Graduate Studies and Research 399 Applied Sciences University of California Santa Cruz, CA 95064 To the recommender: Please write a statement of reference concerning Applicant's name for admission to the graduate program in . Your comments
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/partD.PS, 19920420 Part D STATEMENT OF PURPOSE Please describe your plans for graduate study or research and for your future occupation or profession. Include any information which may aid the selection committee in judging your preparation and qualifications for graduate study at the University of California, Santa Cruz.
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/data.PS, 19920420 DATA CARD (Please type or print neatly) Name: Program: (last, first middle) (applying to) Other Name: Degree Objective: (last, first middle) (Ph.D., M.A., M.S., Certificate) Social Security Number: Quarter applying for: (e.g. Fall 1993) Colleges and Universities attended: Recommenders: (see data card
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/postcard.PS, 19920420 UC SANTA CRUZ APPLICANT GRADUATE STUDIES AND RESEARCH PLACE SANTA CRUZ, CA 95064 STAMP HERE (name) (address) (city) state) (zip) ACKNOWLEDGEMENT CARD UC SANTA CRUZ APPLICANT GRADUATE STUDIES AND RESEARCH PLACE SANTA CRUZ, CA 95064 STAMP HERE (name) (address) (city) (state) (zip) STATUS CARD UNIVERSITY
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/fs.PS, 19920420 FACT SHEET UCSC GRADUATE PROGRAMS AND DEADLINES BOARD OF STUDIES DEADLINE DEGREE GRE REQUIREMENTS ANTHROPOLOGY January 31, 1993 Ph.D. GRE ** ART March 16, 1993 Certificate No GRE Required ASTRONOMY AND ASTROPHYSICS January 31, 1993 Ph.D. GRE and Advanced Test in Physics recommended BIOLOGY January 16,
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/partC.PS, 19920420 Part C APPLICATION FOR FINANCIAL SUPPORT Name: Graduate Program (as listed in the fact sheet): For which of the following sources of support are you applying Any fellowship award available in this graduate program Research Assistantship or Teaching Assistantship Nonresident tuition fellowship
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/partA.PS, 19920420 Graduate Application for Admission Part A University of California, Santa Cruz Applying for: Fall 1992 3 Winter 1993 (Chemistry and Education only) Spring 1993 (Chemistry and Education only) Legal Family Name (Surname) First Name (Given Name) Middle Name U.S. Social Security Number Proposed Program and
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/partE.PS, 19920420 Part E GRADUATE OPPORTUNITY FELLOWSHIP - PERSONAL STATEMENT Graduate Opportunity Fellowships are awarded on the basis of academic merit to applicants from groups that have been historically underrepresented in graduate programs. High priority will be given to Black Americans, Native Americans, Mexican
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/name.PS, 19920420 APPLICANT'S NAME (last, first middle)
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/partB.PS, 19920420 Part B GRE scores must be received by the Graduate Studies Office prior to the application deadline. Have you taken the GRE General Test Yes No Date(s) taken Scores, if known Verbal _______/______% Quantitative _______/______% Analytical _______/______% Have you taken the GRE Subject Test Yes No Date(s)
	ftp://ftp.cse.ucsc.edu//pub/ucsc/old/envel.PS, 19920420 DIVISION OF GRADUATE STUDIES AND RESEARCH 399 APPLIED SCIENCES UNIVERSITY OF CALIFORNIA SANTA CRUZ, CALIFORNIA 95064 Application Checklist Application Fee Graduate Application, Parts A, B, C Statement of Purpose, Part D Graduate Opportunity Fellowship - Personal Statement, Part E (optional) Official
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-90-63.ps.Z, 19920709 On the Computational Complexity of Approximating Distributions by Probabilistic Automata Naoki Abe Manfred K. Warmuth UCSC-CRL-90-63 December 28, 1990 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA Supported by the Office of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-21.ps.Z, 19920709 Quorum-oriented multicast protocols for data replication Richard A. Golding and Darrell D. E. Long UCSC{CRL{91{21 June 12, 1991 Concurrent Systems Laboratory Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Many wide-area distributed applications use replicated
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-46.ps.Z, 19920709 Swift: Using Distributed Disk Striping to Provide High I/O Data Rates Luis-Felipe Cabrera Computer Science Department IBM Almaden Research Center Darrell D. E. Longy Computer & Information Sciences University of California, Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-01.ps.Z, 19920709 Accessing Replicated Data in a Large-Scale Distributed System Richard Golding Darrell D. E. Long Concurrent Systems Laboratory Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz January 10, 1991
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-15.ps.Z, 19920709 A Pattern-Weight Formulation of Search Knowledge Robert Levinson Department of Computer and Information Sciences University of California Santa Cruz Santa Cruz, CA 95064 U.S.A. (408)459-2087 ARPANET:levinson%saturnucscc.ucsc.edu UUCP:ucbvax!ucsc!saturn!levinson
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-18.ps.Z, 19920709 University of California Santa Cruz Accessing replicated data in a large-scale distributed system A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer and Information Sciences by Richard Andrew Golding June 1991 The thesis of Richard Andrew
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-21.ps.Z, 19920709 UNIVERSITY OF CALIFORNIA SANTA CRUZ Automatic Process Selection for Load Balancing A thesis submitted in partial satisfaction of the requirements for the degree of MASTER OF SCIENCE in COMPUTER ENGINEERING by William Osser June 1992 The thesis of William Osser is approved: Prof. Darrell D. E. Long Prof.
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-13.ps.Z, 19920709 Group membership in the epidemic style Richard A. Golding and Kim Taylor UCSC CRL 92 13 May 4, 1992 Concurrent Systems Laboratory Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Existing group membership mechanisms provide consistent views of membership
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-16.ps.Z, 19920709 D. Haussler. Generalizing the PAC model for neural net and other learning applications. Information and Computation, 1990. to appear. D. Haussler. Learning conjunctive concepts in structural domains. Machine Learning, 4:70, 1989. D. Haussler. Quantifying inductive bias: AI learning
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-10.ps.Z, 19920709 References 25 (Tesauro, 1992) Gerald Tesauro. Practical issues in temporal difference learning. Machine Learning, 1992. To appear in Special Issue on reinforcement learning, Richard Sutton, editor. (Thompson and Roycroft, 1983) K. Thompson and A. J. Roycroft. A prophesy fulfilled. EndGame,
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-06.ps.Z, 19920709 Routability-Driven Technology Mapping for LookUp Table-Based FPGAs Martine Schlag, Jackson Kong and Pak K. Chan February 7, 1992
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-16.ps.Z, 19920709 Feasibility Study on the Costs of IDDQ testing in CMOS Circuits F. Joel Ferguson Tracy Larrabeey Computer Engineering Board of Studies, University of California, Santa Cruz 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-29.ps.Z, 19920709 22 A. Some proofs we have 1 X t=1 (>=t aet k )2 <= LA(G; N=ff2): Hence, 1 X t=1 ((ff>=t + k) aet)2 = 2 1 X t=1 (>=t aet k )2 <= 2LA(G; N=ff2): The theorem follows from the fact that S was chosen arbitrarily. A.2 Proof of Lemma 5 Fix z; ffi > 0. Define f : ! R by f(x) = ln (x + z + ffi )(1 x +
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-02.ps.Z, 19920709 Decision Theoretic Generalizations of the PAC Model for Neural Net and Other Learning Applications David Haussler September, 1989 Revised: December, 1990 Revised again: January, 1992 haussler@saturn.ucsc.edu Baskin Center for Computer Engineering and Information Sciences University of California, Santa
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-08.ps.Z, 19920709 Exploiting Multiple I/O Streams to Provide High Data-Rates Luis-Felipe Cabrera IBM Almaden Research Center Computer Science Department Internet: cabrera@ibm.com Darrell D. E. Long Computer & Information Sciences University of California at Santa Cruz Internet: darrell@sequoia.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-22.ps.Z, 19920709 University of California Santa Cruz Towards a More Comprehensive Theory of Learning in Computers A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Philip M. Long June 1992 The dissertation of Philip M. Long
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-37.ps.Z, 19920709 Experience-Based Creativity Robert Levinson Department of Computer and Information Sciences University of California Santa Cruz Santa Cruz, CA 95064 U.S.A. (408)459-2087 ARPANET:levinson@cis.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-89-42.ps.Z, 19920709 Analyzing Traces with Anonymous Synchronization David P. Helmbold Charles E. McDowell Jian-Zhong Wang UCSC-CRL-89-42 December, 1989 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-42.ps.Z, 19920709 XS - XILINX 2000/3000 FPGA Simulator Jason Zien, Jackson Kong, Pak K. Chan, Martine Schlag October 17, 1991 1 Introduction With the growing complexity of field programmable gate arrays (FPGA), there is the growing need for sophisticated design tools to provide higher level abstractions for managing
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-19.ps.Z, 19920709 Swift: A Storage Architecture for Large Objects Luis-Felipe Cabrera Computer Science Department IBM Almaden Research Center Internet: cabrera@ibm.com Darrell D. E. Long Computer & Information Sciences University of California at Santa Cruz Internet: darrell@sequoia.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-30.ps.Z, 19920709 The Performance of Weak-consistency Replication Protocols Richard A. Golding Darrell D. E. Long UCSC CRL 92 30 July 6, 1992 Concurrent Systems Laboratory Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Weak-consistency replication protocols can be used to
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-36.ps.Z, 19920709 Proc. 10th International Phoenix Conference on Computers and Communication (1991), to appear Resilient Memory-Resident Data Objects Jehan-Franc,ois Pa ris Darrell D. E. Long Department of Computer Science Computer and Information Sciences University of Houston University of California Houston, TX
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-88-28.ps.Z, 19920709 References 21 Michael R. Garey and David S. Johnson. Computers and Intractability, A Guide to the Theory of NP-Completeness. W. H. Freeman and Company, San Francisco, CA, 1979. Kevin Karplus. Exclusion constraints, a new application of graph algorithms to VLSI design. In 4th MIT
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-01.ps.Z, 19920709 Accessing Replicated Data in a Large-Scale Distributed System Richard Golding Darrell D. E. Long Concurrent Systems Laboratory Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz January 10, 1991
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-23.ps.Z, 19920709 References 15 Arie Kaufman and Reuven Bakalash. Memory and processor architecture for 3D voxel-based imagery. IEEE Computer Graphics and Applications, 8(11):103, November 1988. Arie Kaufman, Reuven Bakalash, Daniel Cohen, and Roni Yagel. A survey of architectures for volume rendering.
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-44.ps.Z, 19920709 Bounds on the Sample Complexity of Bayesian Learning Using Information Theory and the VC Dimension UCSC-CRL-91-44 David Haussler U.C. Santa Cruz Michael Kearns y AT&T Bell Labs Robert Schapire z AT&T Bell Labs March 17, 1992
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-42.ps.Z, 19920709 XS - XILINX 2000/3000 FPGA Simulator Jason Zien, Jackson Kong, Pak K. Chan, Martine Schlag October 17, 1991 1 Introduction With the growing complexity of field programmable gate arrays (FPGA), there is the growing need for sophisticated design tools to provide higher level abstractions for managing
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-16.ps.Z, 19920709 Feasibility Study on the Costs of IDDQ testing in CMOS Circuits F. Joel Ferguson Tracy Larrabeey Computer Engineering Board of Studies, University of California, Santa Cruz 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-46.ps.Z, 19920709 A Study of the Reliability of Internet Sites D. D. E. Long J. L. Carroll, C. J. Park Computer & Information Sciences Mathematical Sciences University of California San Diego State University Santa Cruz, CA 95064 San Diego, CA 92182 (408) 459-2616 (619) 594-7242, (619) 594-6171 darrell@cis.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-30.ps.Z, 19920709 The Performance of Weak-consistency Replication Protocols Richard A. Golding Darrell D. E. Long UCSC CRL 92 30 July 6, 1992 Concurrent Systems Laboratory Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Weak-consistency replication protocols can be used to
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-10.ps.Z, 19920709 Approximation Properties of NP Minimization Classes Phokion G. Kolaitis Madhukar N. Thakury UCSC-CRL-91-10 April 1991 Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-24.ps.Z, 19920709 A Further Note on Hennessy's Symbolic Debugging of Optimized Code" Max Copperman Charles E. McDowell UCSC-CRL-92-24 Supersedes UCSC-CRL-91-04 April 1992 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-04.ps.Z, 19920709 Proceedings of the Annual Simulation Symposium (to appear). A Simulation Study of Replication Control Protocols Using Volatile Witnesses Perry K. Sloope Jehan-Franc,ois Pa ris Darrell D.E. Long Department of Computer Science Computer and Information Sciences University of Houston University of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-01.ps.Z, 19920709 Debugging Optimized Code Without Being Misled Max Copperman 92-01 May 8, 1992 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-07.ps.Z, 19920709 26 7. Appendix 7. Appendix In order to give the reader a flavor of how the JPEG algorithms affect the reconstructed images, we attached three pairs, an original image and its difference image generated from our simulation. In the beginning, we tried to take photographs of the original images and the
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-44.ps.Z, 19920709 Bounds on the Sample Complexity of Bayesian Learning Using Information Theory and the VC Dimension UCSC-CRL-91-44 David Haussler U.C. Santa Cruz Michael Kearns y AT&T Bell Labs Robert Schapire z AT&T Bell Labs March 17, 1992
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-34.ps.Z, 19920709 Accessing Replicated Data in an Internetwork Richard Golding Darrell D.E. Long Computer and Information Sciences University of California Santa Cruz, CA 95064 August 23, 1990
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-25.ps.Z, 19920709 Producing an Accurate Call-Stack Trace in the Occasional Absence of Frame Pointers Max Copperman UCSC-CRL-92-25 Supersedes UCSC-CRL-90-62 March 1992 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-02.part1.ps.Z, 19920709 Decision Theoretic Generalizations of the PAC Model for Neural Net and Other Learning Applications David Haussler September, 1989 Revised: December, 1990 Revised again: January, 1992 haussler@saturn.ucsc.edu Baskin Center for Computer Engineering and Information Sciences University of California, Santa
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-10.ps.Z, 19920709 References 25 (Tesauro, 1992) Gerald Tesauro. Practical issues in temporal difference learning. Machine Learning, 1992. To appear in Special Issue on reinforcement learning, Richard Sutton, editor. (Thompson and Roycroft, 1983) K. Thompson and A. J. Roycroft. A prophesy fulfilled. EndGame,
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-37.ps.Z, 19920709 Experience-Based Creativity Robert Levinson Department of Computer and Information Sciences University of California Santa Cruz Santa Cruz, CA 95064 U.S.A. (408)459-2087 ARPANET:levinson@cis.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-43.ps.Z, 19920709 References 17 Xmap (including merge) Amap XAmap subsets name f = 2 f = 3 f = 4 f = 5 10bitreg 0.78 0.83 0.82 0.83 0.75 1.13 XT 10count 1.38 1.23 1.25 1.18 1.18 1.70 XT 180degc 1.68 1.40 1.35 1.35 1.23 1.80 XT 3to8dmux 1.52 1.37 1.38 1.32 1.17 1.78 XT 4-16dec 0.88 0.85 0.85 0.92 0.83 1.25 XT 4cnt 1.03
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-89-42.ps.Z, 19920709 Analyzing Traces with Anonymous Synchronization David P. Helmbold Charles E. McDowell Jian-Zhong Wang UCSC-CRL-89-42 December, 1989 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-10.ps.Z, 19920709 Approximation Properties of NP Minimization Classes Phokion G. Kolaitis Madhukar N. Thakury UCSC-CRL-91-10 April 1991 Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-88-29.ps.Z, 19920709 References 19 Kenneth J. Supowit and Steven J. Friedman. A new method for verifying sequential circuits. In ACM IEEE 23rd Design Automation Conference Proceedings, pages 20007, Las Vegas, NV, 29 June July 1986. 18 References Robert K. Brayton, Gary D. Hachtel, Curtis T. McMullen, and
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-40.ps.Z, 19920709 Force-Driven Constrained Wiring Optimization Tal Dayan* Wayne Wei-Ming Dai* UCSC-CRL-91-40 October 10 1991 Board of Studies in Computer Engeeniring University of California at Santa Cruz Santa Cruz, CA 95064 EMail: tal@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-90-43.ps.Z, 19920709 References 17 Xmap (including merge) Amap XAmap subsets name f = 2 f = 3 f = 4 f = 5 10bitreg 0.78 0.83 0.82 0.83 0.75 1.13 XT 10count 1.38 1.23 1.25 1.18 1.18 1.70 XT 180degc 1.68 1.40 1.35 1.35 1.23 1.80 XT 3to8dmux 1.52 1.37 1.38 1.32 1.17 1.78 XT 4-16dec 0.88 0.85 0.85 0.92 0.83 1.25 XT 4cnt 1.03
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-15.ps.Z, 19920709 18 References References N. Alon. On the density of sets of vectors. Discrete Mathematics, 24, 177-184, 1983. A. Blumer, A. Ehrenfeucht, D. Haussler, and M.K. Warmuth. Learnability and the Vapnik-Chervonenkis dimension. JACM, 36(4), 1989. J.A. Bondy. Induced subsets. Journal of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-63.ps.Z, 19920709 On the Computational Complexity of Approximating Distributions by Probabilistic Automata Naoki Abe Manfred K. Warmuth UCSC-CRL-90-63 December 28, 1990 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA Supported by the Office of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-41.ps.Z, 19920709 Sphere Packing Numbers for Subsets of the Boolean n-Cube with Bounded Vapnik-Chervonenkis Dimension David Haussler1 haussler@cse.ucsc.edu UCSC-CRL-91-41 October, 1991, revised March, 1992 Department of Computer and Information Sciences University of California, Santa Cruz, CA 95064 and Mathematical
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-19.ps.Z, 19920709 Swift: A Storage Architecture for Large Objects Luis-Felipe Cabrera Computer Science Department IBM Almaden Research Center Internet: cabrera@ibm.com Darrell D. E. Long Computer & Information Sciences University of California at Santa Cruz Internet: darrell@sequoia.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-09.ps.Z, 19920709 Voting with Regenerable Volatile Witnesses Darrell D.E. Long Computer and Information Sciences University of California Santa Cruz, CA 95064 Jehan-Franc,ois Pa ris Department of Computer Science University of Houston Houston, TX 77204-3475
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-27.ps.Z, 19920709 18 6. Conclusions and Ongoing Directions G. Tesauro and T. J. Sejnowski. A parallel network that learns to play backgammon. Artificial Intelligence, 39:35790, 1989. Gerald Tesauro. Practical issues in temporal difference learning. IBM Thomas J. Watson
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-02.ps.Z, 19920709 50 Appendix A. Sample Analyses System: ------cache------ Main instr data CPU Memory Tmem 2.5 2.5 20 Bw 16 16 Bk 1 TPIb 2.5 A 0.95 B 0.75 pf 2 OUTPUT Cache Model: ------cache------ instr data Cmr 0.080 0.038 P/I Model: ------cache------ Main instr data CPU Memory Rm-bar 1.33 1.33 1.11 Fp 0.35 0.35 1.39
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-19.ps.Z, 19920709 Dynamic Storage Reclamation in C++ Daniel Ross Edelson daniel@cis.ucsc.edu UCSC-CRL-90-19 June 1990 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064 Copyright c by Daniel Ross Edelson 1990 iii Contents
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-29.ps.Z, 19920709 22 A. Some proofs we have 1 X t=1 (>=t aet k ff )2 <= LA(G; N=ff2): Hence, 1 X t=1 ((ff>=t + k) aet)2 = ff2 1 X t=1 (>=t aet k ff )2 <= ff2LA(G; N=ff2): The theorem follows from the fact that S was chosen arbitrarily. A.2 Proof of Lemma 5 Fix z; ffi > 0. Define f : ! R by f(x) = ln (x + z + ffi
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-31.ps.Z, 19920709 References 17 D. Helmbold, R. Sloan and M.K. Warmuth. Learning Lattices and Reversible, Commutative Regular Languages. Proceedings of the Third Workshop on Computational Learning Theory, 1990. D. Helmbold and G. Pagallo. There is No Continuous Prediction Preserving Reduction Between the
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-14.ps.Z, 19920709 Pattern Associativity and the Retrieval of Semantic Networks Robert Levinson Department of Computer and Information Sciences University of California Santa Cruz Santa Cruz, CA 95064 U.S.A. (408)459-2087 ARPANET:levinson%saturnucscc.ucsc.edu UUCP:ucbvax!ucsc!saturn!levinson
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-90-09.ps.Z, 19920709 Voting with Regenerable Volatile Witnesses Darrell D.E. Long Computer and Information Sciences University of California Santa Cruz, CA 95064 Jehan-Franc,ois Pa ris Department of Computer Science University of Houston Houston, TX 77204-3475
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-40.ps.Z, 19920709 Force-Driven Constrained Wiring Optimization Tal Dayan* Wayne Wei-Ming Dai* UCSC-CRL-91-40 October 10 1991 Board of Studies in Computer Engeeniring University of California at Santa Cruz Santa Cruz, CA 95064 EMail: tal@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-18.ps.Z, 19920709 University of California Santa Cruz Accessing replicated data in a large-scale distributed system A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer and Information Sciences by Richard Andrew Golding June 1991 The thesis of Richard Andrew
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-35.ps.Z, 19920709 Protecting Replicated Objects Against Media Failures Jehan-Franc,ois Pa ris Department of Computer Science University of Houston Houston, TX 77204-3475 Darrell D.E. Long Computer and Information Sciences University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-06.ps.Z, 19920709 Estimating the Reliability of Hosts Using the Internet D. D. E. Long J. L. Carroll, C. J. Park Computer & Information Sciences Mathematical Sciences University of California San Diego State University Santa Cruz, CA 95064 San Diego, CA 92182 (408) 459-2616 (619) 594-7242, (619) 594-6171
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-63.part1.ps.Z, 19920709 On the Computational Complexity of Approximating Distributions by Probabilistic Automata Naoki Abe Manfred K. Warmuth UCSC-CRL-90-63 December 28, 1990 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA Supported by the Office of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-19-nocode.ps.Z, 19920709 Dynamic Storage Reclamation in C++ Daniel Ross Edelson daniel@cis.ucsc.edu UCSC-CRL-90-19 June 1990 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064 Copyright c by Daniel Ross Edelson 1990 iii Contents
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-63.part2.ps.Z, 19920709 48 Figure C.3: The deterministic automaton corresponding to `true.' Figure C.4: The deterministic automaton corresponding to `false.' C. Figures 47 Figure C.2: The four boolean functions on two variables. 46 Figure C.1: An example probabilistic automaton. C. Figures 45 If we divide the path set for ui
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-02.part2.ps.Z, 19920709 David Touretsky. Advances in Neural Information Processing Systems, volume 1. Morgan Kaufmann, 1989. David Touretsky. Advances in Neural Information Processing Systems, volume 2. Morgan Kaufmann, 1990. Leslie G. Valiant. A theory of the learnable. Communications of the ACM,
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-36.ps.Z, 19920709 28 References (B) Three variations of orderings from H Orderings from HT r' r s s' q q' q' q s' s r r' q' q r' r s s' (A) s' s q' q r' r (C) Figure A.1: Possible orderings for Lemma 2. Variable v is read in block B(s,s') and written in blocks B(r,r') and B(q,q'). Variable v is assumed to have different
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-21.ps.Z, 19920709 UNIVERSITY OF CALIFORNIA SANTA CRUZ Automatic Process Selection for Load Balancing A thesis submitted in partial satisfaction of the requirements for the degree of MASTER OF SCIENCE in COMPUTER ENGINEERING by William Osser June 1992 The thesis of William Osser is approved: Prof. Darrell D. E. Long Prof.
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-90-15.ps.Z, 19920709 18 References References N. Alon. On the density of sets of vectors. Discrete Mathematics, 24, 177-184, 1983. A. Blumer, A. Ehrenfeucht, D. Haussler, and M.K. Warmuth. Learnability and the Vapnik-Chervonenkis dimension. JACM, 36(4), 1989. J.A. Bondy. Induced subsets. Journal of
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-90-31.ps.Z, 19920709 References 17 D. Helmbold, R. Sloan and M.K. Warmuth. Learning Lattices and Reversible, Commutative Regular Languages. Proceedings of the Third Workshop on Computational Learning Theory, 1990. D. Helmbold and G. Pagallo. There is No Continuous Prediction Preserving Reduction Between the
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-48.ps.Z, 19920709 Logical Definability of NP Optimization Problems Phokion G. Kolaitis Madhukar N. Thakury UCSC-CRL-90-48 September 1990 Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-02.ps.Z, 19920709 50 Appendix A. Sample Analyses System: ------cache------ Main instr data CPU Memory Tmem 2.5 2.5 20 Bw 16 16 Bk 1 TPIb 2.5 A 0.95 B 0.75 pf 2 OUTPUT Cache Model: ------cache------ instr data Cmr 0.080 0.038 P/I Model: ------cache------ Main instr data CPU Memory Rm-bar 1.33 1.33 1.11 Fp 0.35 0.35 1.39
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-57.part2.ps.Z, 19920710 16 4. Generalizing the Semaphore Model Let Seq1 be the set of event pairs which are in Conc but are ordered by the temporary time vectors. After obtaining Seq1, the original time vectors are restored. We can not yet move these events from Conc to Seq since they may be concurrent in executions where e0
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-58.part1.ps.Z, 19920710 Computing Reachable States of Parallel Programs David P. Helmbold Charles E. McDowell July 8, 1992 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-57.part1.ps.Z, 19920710 Detecting Data Races by Analyzing Sequential Traces David P. Helmbold Charles E. McDowell Jian-Zhong Wang 90-57 October 17, 1990 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-57.ps.Z, 19920710 Detecting Data Races by Analyzing Sequential Traces David P. Helmbold Charles E. McDowell Jian-Zhong Wang 90-57 October 17, 1990 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-58.part2.ps.Z, 19920710 3. The task-map 11 Complete bipartite graph AFTER MakeCluster the xi may have different sucessors x1 x2 xn y1 y2 yn all xi have the same predecessors but
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-90-58.ps.Z, 19920710 Computing Reachable States of Parallel Programs David P. Helmbold Charles E. McDowell July 8, 1992 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-36.ps.Z, 19920724 Multi-Level Hierarchical Retrieval Robert Levinson and Gerard Ellis y
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-36.ps.Z, 19920724 Multi-Level Hierarchical Retrieval Robert Levinson and Gerard Ellis y
	ftp://ftp.cse.ucsc.edu//pub/ucsc/grad.app/b-6-91.PS, 19920729 Part B GRE scores must be received by the Graduate Studies Office prior to the application deadline. Have you taken the GRE General Test Yes No Date(s) taken Scores, if known Verbal _______/______% Quantitative _______/______% Analytical _______/______% Have you taken the GRE Subject Test Yes No Date(s)
	ftp://ftp.cse.ucsc.edu//pub/ucsc/grad.app/a-6-91.PS, 19920729 Graduate Application for Admission Part A University of California, Santa Cruz Applying for: Fall ______ Winter ______ (Chemistry and Education only) Spring _______ (Chemistry and Education only) Legal Family Name (Surname) First Name (Given Name) Middle Name U.S. Social Security Number Proposed Program
	ftp://ftp.cse.ucsc.edu//pub/ucsc/grad.app/waiver.PS, 19920729 UNIVERSITY OF CALIFORNIA, SANTA CRUZ WAIVER OF ACCESS TO CONFIDENTIAL LETTERS OF RECOMMENDATION NAME OF APPLICANT (please print) Last Name, First Middle TO THE APPLICANT: The Family Educational Rights and Privacy Act of 1974 gives students (persons admitted and enrolled) the right to inspect letters of
	ftp://ftp.cse.ucsc.edu//pub/ucsc/grad.app/c-6-91.PS, 19920729 Part C APPLICATION FOR FINANCIAL SUPPORT Name: Graduate Program (as listed in the fact sheet): For which of the following sources of support are you applying Any fellowship award available in this graduate program Research Assistantship or Teaching Assistantship Nonresident tuition fellowship
	ftp://ftp.cse.ucsc.edu//pub/ucsc/grad.app/d-6-91.PS, 19920729 Part D STATEMENT OF PURPOSE Please describe your plans for graduate study or research and for your future occupation or profession. Include any information which may aid the selection committee in judging your preparation and qualifications for graduate study at the University of California, Santa Cruz.
	ftp://ftp.cse.ucsc.edu//pub/ucsc/grad.app/lr-6-91.1.PS, 19920729 Recommendation for Admission Please use this form and return to: Division of Graduate Studies and Research 302 Applied Sciences University of California Santa Cruz, CA 95064 To the recommender: Please write a statement of reference concerning Applicant's name for admission to the graduate program in .
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-28.ps.Z, 19920810 Precompiling C++ for Garbage Collection Daniel R. Edelson UCSC{CRL{92{28 23 June 1992 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA Part of this research was performed while the author was a visiting researcher at INRIA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-27.ps.Z, 19920810 Smart Pointers: They're Smart, but They're Not Pointers Daniel R. Edelson UCSC{CRL{92{27 10 June 1992 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA This research was performed while the author was a visiting researcher at
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-31.ps.Z, 19920811 A weak-consistency architecture for distributed information services Richard A. Golding UCSC CRL 92 31 July 6, 1992 Concurrent Systems Laboratory Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Services provided on wide-area networks like the Internet present
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-26.ps.Z, 19920811 End-to-end performance prediction for the Internet (Work in progress) Richard A. Golding UCSC CRL 92 26 June 19, 1992 Concurrent Systems Laboratory Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Many applications designed for wide-area systems use replication
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-14.ps.Z, 19920813 A Replicated Monitoring Tool Darrell D. E. Longy Computer & Information Sciences University of California, Santa Cruz
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-14.ps.Z, 19920813 A Replicated Monitoring Tool Darrell D. E. Longy Computer & Information Sciences University of California, Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-23.ps.Z, 19920929 Protein Modeling using Hidden Markov Models: Analysis of Globins David Hausslery, Anders Kroghy, I. Saira Mianx, Kimmen Sj olandery y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. haussler@cse.ucsc.edu, krogh@cse.ucsc.edu UCSC-CRL-92-23
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-23.ps.Z, 19920929 Protein Modeling using Hidden Markov Models: Analysis of Globins David Hausslery, Anders Kroghy, I. Saira Mianx, Kimmen Sjolandery y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. haussler@cse.ucsc.edu, krogh@cse.ucsc.edu UCSC-CRL-92-23
	ftp://ftp.cse.ucsc.edu//pub/tcos/v6n1/cover.ps, 19921007 Chairman Jehan-Fran ois P ris Department of Computer Science University of Houston Houston, TX 77204-3475 (713) 749-3943 paris@cs.uh.edu Vice-Chairman Willy Zwaenepoel Rice University willy@rice.edu Editors Terry Slattery Chesapeake Computer Consultants, Inc. 2816 Southaven Drive Annapolis, MD 21401
	ftp://ftp.cse.ucsc.edu//pub/tcos/v6n1/mosix.ps, 19921007 MOSIX The Hebrew University of Jerusalem, Israel Personnel Principal investigator Amnon Barak Gad Aharoni Ron Ben-Natan Shai Guday Michal Miskin Ury Segal Yuval Yarom Contact Prof. Amnon Barak Department of Computer Science The Hebrew University of Jerusalem Jerusalem 91904, Israel amnon@cs.huji.ac.il
	ftp://ftp.cse.ucsc.edu//pub/tcos/v6n1/gothic.ps, 19921007 The Gothic project IRISA Equipe LSP Campus de Beaulieu 35042 Rennes C edex FRANCE Personnel Principal investigator Michel Ban atre Research staff Pascale Le Certen Gilles Muller Christine Morin Students Yasmina Belhamissi Marc Benveniste Pack Heng Val erie Issarny Philippe Joubert Isabelle Puaut Bruno
	ftp://ftp.cse.ucsc.edu//pub/tcos/v6n1/psyche.ps, 19921007 The Psyche Parallel Operating System Computer Science Department University of Rochester Personnel Principal investigators Tom LeBlanc Michael Scott Students Brian Marsh Evangelos Markatos Cezary Dubnicki Mark Crovella Professional staff Tim Becker Additional contributions by Chris Brown, Sean Colbath,
	ftp://ftp.cse.ucsc.edu//pub/tcos/v6n1/jade.ps, 19921007 The Jade File System Herman C. Rao, Larry L. Peterson Personnel and Contact Herman ChungHwa Rao Bell Laboratories Murray Hill, NJ. herman@ulysses.att.com Larry L. Peterson Department of Computer Science University of Arizona llp@cs.arizona.edu Project Description Jade is an internet file system that
	ftp://ftp.cse.ucsc.edu//pub/tcos/v6n1/front-matter.ps, 19921007 2 Volume 6 Number 1 TCOS Newsletter How to get the Newsletter There are four ways to receive the TCOS newsletter electronically: Usenet news, anonymous FTP, using the electronic mail server, and having electronic issues mailed to you directly. The preferred method is Usenet news since it allows the
	ftp://ftp.cse.ucsc.edu//pub/tcos/v6n1/mars.ps, 19921007 The Distributed, Fault-Tolerant Real-Time Operating System MARS H. Kopetz, G. Fohler, G. Gr unsteidl, H. Kantz, G. Pospischil, P. Puschner, J. Reisinger, R. Schlatterbeck, W. Sch utz, A. Vrchoticky, R. Zainlinger Department of Real-Time Systems Technical University of Vienna, Austria Personnel and
	ftp://ftp.cse.ucsc.edu//pub/tcos/v6n1/kannan.ps, 19921007 Support Environment for Network Computing Concurrent Engineering Research Center, West Virginia University Project Description The main objective of our work is to provide a software support environment suitable for distributed computing in a heterogeneous environment. The support environment known as
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-43.ps.Z, 19921008 1 S-Parameter Based Macro Model of Distributed-Lumped Networks Using Pade Approximation Extended Abstract 1. Introduction Designing of large scale high performance circuits requires precise knowledge of circuit delays. The computation of delays associated with interconnects, in particular, poses a
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-45.ps.Z, 19921012 Design choices for weak-consistency group communication Richard A. Golding and Darrell D. E. Long UCSC TR 92 45 October 12, 1992 Concurrent Systems Laboratory Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Many wide-area distributed applications can be
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-46.ps.Z, 19921014 Some Future Directions in Fault Modeling and Test Pattern Generation Research F. Joel Ferguson and Tracy Larrabee Computer Engineering Department University of California, Santa Cruz Santa Cruz, CA. 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-46.ps.Z, 19921014 Some Future Directions in Fault Modeling and Test Pattern Generation Research F. Joel Ferguson and Tracy Larrabee Computer Engineering Department University of California, Santa Cruz Santa Cruz, CA. 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-37.ps.Z, 19921015 How Well do Bayes Methods Work for On-Line Prediction of f 1g values D. Haussler Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz, CA 95064 haussler@cse.ucsc.edu A. Barron 713 Wright Street Dept. of Statistics, U. Ill. Champaign IL 61820
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-37.ps.Z, 19921015 How Well do Bayes Methods Work for On-Line Prediction of f 1g values D. Haussler Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz, CA 95064 haussler@cse.ucsc.edu A. Barron 713 Wright Street Dept. of Statistics, U. Ill. Champaign IL 61820
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-43.ps.Z, 19921016 Calculation of the Learning Curve of Bayes Optimal Classification Algorithm for Learning a Perceptron With Noise Manfred Opper Institut fuer Theoretische Physik Justus-Liebig-Universitaet Giessen Giessen, Germany maopper@dgihrz01.bitnet David Haussler Computer and Information Sciences U.C. Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-19.ps.Z, 19921016 Spectral K-Way Ratio-Cut Partitioning Part I: Preliminary Results Pak K. Chan, Martine Schlag and Jason Zien Computer Engineering Board of Studies University of California, Santa Cruz May, 1992
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-09.ps.Z, 19921019 Using Data Striping in a Local Area Network Luis-Felipe Cabrera IBM Almaden Research Center Computer Science Department Internet: cabrera@almaden.ibm.com Darrell D. E. Long Computer & Information Sciences University of California at Santa Cruz Internet: darrell@cis.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-30.ps.Z, 19921019 Test Pattern Generation for Realistic Bridge Faults in CMOS ICs F. Joel Ferguson and Tracy Larrabee UCSC-CRL-91-30 August 23, 1991 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-45.ps.Z, 19921019 BORG: A Reconfigurable Prototyping Board using Field-Programmable Gate Arrays Pak K. Chan , Martine D.F. Schlagy, and Marcelo Martinzx Computer Engineering University of California, Santa Cruz Santa Cruz, California 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-45.ps.Z, 19921019 BORG: A Reconfigurable Prototyping Board using Field-Programmable Gate Arrays Pak K. Chan , Martine D.F. Schlagy, and Marcelo Martinzx Computer Engineering University of California, Santa Cruz Santa Cruz, California 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-09.ps.Z, 19921019 Using Data Striping in a Local Area Network Luis-Felipe Cabrera IBM Almaden Research Center Computer Science Department Internet: cabrera@almaden.ibm.com Darrell D. E. Long Computer & Information Sciences University of California at Santa Cruz Internet: darrell@cis.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-22.ps.Z, 19921019 Empirical Evaluation of Multilevel Logic Minimization Tools For a Lookup Table-based Field-Programmable Gate Array Technology Martine Schlag, Pak K. Chan and Jackson Kong Computer Engineering University of California, Santa Cruz Santa Cruz, California 95064, U.S.A.
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-30.ps.Z, 19921019 Test Pattern Generation for Realistic Bridge Faults in CMOS ICs F. Joel Ferguson and Tracy Larrabee UCSC-CRL-91-30 August 23, 1991 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-22.ps.Z, 19921019 Empirical Evaluation of Multilevel Logic Minimization Tools For a Lookup Table-based Field-Programmable Gate Array Technology Martine Schlag, Pak K. Chan and Jackson Kong Computer Engineering University of California, Santa Cruz Santa Cruz, California 95064, U.S.A.
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-34.ps.Z, 19921030 UNIVERSITY OF CALIFORNIA SANTA CRUZ Census : Collecting Host Information on a Wide Area Network A thesis submitted in partial satisfaction of the requirements for the degree of BACHELOR OF ARTS in COMPUTER AND INFORMATION SCIENCE by Nitin K. Ganatra June 1992 The thesis of Nitin K. Ganatra is approved:
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-47.ps.Z, 19921102 Using the ucsc-report LaTEX style file for UCSC technical reports Kevin Karplus UCSC-CRL-92-47 supersedes UCSC-CRL-90-25 and UCSC-CRL-87-10 29 October 1992 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-15.ps.Z, 19921109 Sorting and Searching With a Faulty Comparison Oracle Philip M. Long UCSC-CRL-92-15 November 9, 1992 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-15.ps.Z, 19921109 Sorting and Searching With a Faulty Comparison Oracle Philip M. Long UCSC-CRL-92-15 November 9, 1992 Board of Studies in Computer and Information Sciences University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-42.ps.Z, 19921111 Evidence for a Satisfiability Threshold for Random 3CNF Formulas Tracy Larrabee Yumi Tsujiy UCSC-CRL-92-42 November 6, 1992 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-24.ps.Z, 19921111 University of California Santa Cruz Carafe: An Inductive Fault Analysis Tool For CMOS VLSI Circuits A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Engineering by Alvin Lun-Knep Jee June 1991 The thesis of Alvin Lun-Knep Jee is approved: F.
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-24.ps.Z, 19921111 University of California Santa Cruz Carafe: An Inductive Fault Analysis Tool For CMOS VLSI Circuits A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Engineering by Alvin Lun-Knep Jee June 1991 The thesis of Alvin Lun-Knep Jee is approved: F.
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-33.ps.Z, 19921111 35 Appendix G. .src File Format Purpose This file contains the COSMOS fault simulation commands to fault simulate the netlist that Carafe generates. Description For each fault, there are two COSMOS commands given in these files. The first command inserts the fault site into the list of faults to
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-32.ps.Z, 19921211 Fault Interpretation: Fine-Grain Monitoring of Page Accesses Daniel R. Edelson INRIA Project SOR Rocquencourt B.P. 105 78153 Le Chesnay CEDEX FRANCE Daniel.Edelson@inria.fr 9 November 1992
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-52.ps.Z, 19921211 UNIVERSITY OF CALIFORNIA SANTA CRUZ Weak-consistency group communication and membership A dissertation submitted in partial satisfaction of the requirements for the degree of DOCTOR OF PHILOSOPHY in COMPUTER AND INFORMATION SCIENCES by Richard Andrew Golding December 1992 The dissertation of Richard
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-32.ps.Z, 19921211 Fault Interpretation: Fine-Grain Monitoring of Page Accesses Daniel R. Edelson INRIA Project SOR Rocquencourt B.P. 105 78153 Le Chesnay CEDEX FRANCE Daniel.Edelson@inria.fr 9 November 1992
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-55.ps.Z, 19921215 o arison o o I le entations o t e o en in riorit nction Ivan Fellner, Ivan acko, ilos acek, arol Fabian Institute of utomation and ommunication Slovak cademy of Sciences zechoslovakia arrell ong omputer Information Sciences niversity of alifornia, Santa ruz bstract s e er r ce s s r e ce e s e e . e
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-20.ps.Z, 19921216 BORG: A Field-Programmable Prototyping Board: User's Guide Pak K. Chan UCSC-CRL-92-20 June 1992 Board of Studies in Computer Engineering University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-39.ps.Z, 19921216 University of California Santa Cruz Geometric Transformations for a Rubber-band Sketch A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Engineering by David Joseph Staepelaere September 1992 The thesis of David Joseph Staepelaere is approved:
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-20.ps.Z, 19921216 BORG: A Field-Programmable Prototyping Board: User's Guide Pak K. Chan UCSC-CRL-92-20 June 1992 Board of Studies in Computer Engineering University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-54.ps.Z, 19921216 On Weak Learning David P. Helmbold and Manfred K. Warmuthy UCSC-CRL-92-54 December 16, 1992 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-38.ps.Z, 19921217 Bounds on Approximate Steepest Descent for Likelihood Maximization in Exponential Families Nicol o Cesa-Bianchi Computer Science Department Universit a di Milano Via Comelico 39/41, 20135 Milano (Italy) cesabian@imiucca.csi.unimi.it Anders Krogh Computer Science Department University of California Santa
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-38.ps.Z, 19921217 Bounds on Approximate Steepest Descent for Likelihood Maximization in Exponential Families Nicol o Cesa-Bianchi Computer Science Department Universit a di Milano Via Comelico 39/41, 20135 Milano (Italy) cesabian@imiucca.csi.unimi.it Anders Krogh Computer Science Department University of California Santa
	ftp://ftp.cse.ucsc.edu//pub/ml/ucsc-crl-91-28.ps.Z, 19921218 The Weighted Majority Algorithm Nick Littlestone Manfred K. Warmuth y UCSC-CRL-91-28 Revised October 26, 1992 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA This research was primarily conducted while this author was at the
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-53.ps.Z, 19921218 A note on bit-mapped free sector management Darrell D. E. Long Computer & Information Sciences University of California, Santa Cruz The most common methods for maintain a list of free sectors on disk are to use either a linked list or a bit map . Using a linked list has the advantage that is requires
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-28.ps.Z, 19921218 The Weighted Majority Algorithm Nick Littlestone Manfred K. Warmuth y UCSC-CRL-91-28 Revised October 26, 1992 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA This research was primarily conducted while this author was at the
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-91-28.ps.Z, 19921218 The Weighted Majority Algorithm Nick Littlestone Manfred K. Warmuth y UCSC-CRL-91-28 Revised October 26, 1992 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA This research was primarily conducted while this author was at the
	ftp://ftp.cse.ucsc.edu//pub/protein/oldpaper.part2.ps.Z, 19921231 3.2 Kinase experiments Protein kinases are defined as enzymes that transfer a phosphate group from a phosphate donor onto an acceptor amino acid in a substrate protein . Despite the differences in size, substrate specificity, mechanism of activation, subunit composition and subcellular lo-
	ftp://ftp.cse.ucsc.edu//pub/protein/oldpaper.part1.ps.Z, 19921231 Hidden Markov Models in Computational Biology: Applications to Protein Modeling Anders Krogh y, Michael Browny, I. Saira Mianx, Kimmen Sj olandery, David Hausslery y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. email:
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-35.ps.Z, 19930104 University of California Santa Cruz Dynamic Constrained Delaunay Triangulation and Application to Multichip Module Layout A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Engineering by Yizhi Lu December 1991 The thesis of Yizhi Lu is
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-92-11.ps.Z, 19930104 Optimal Design of Self-Damped Lossy Transmission Lines in a Tree Network for Multichip Module Jimmy S.-H. Wang and Wayne W.-M. Dai UCSC-CRL-92-11 April 6,1992 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-11.ps.Z, 19930104 Optimal Design of Self-Damped Lossy Transmission Lines in a Tree Network for Multichip Module Jimmy S.-H. Wang and Wayne W.-M. Dai UCSC-CRL-92-11 April 6,1992 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-92-35.ps.Z, 19930104 University of California Santa Cruz Dynamic Constrained Delaunay Triangulation and Application to Multichip Module Layout A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Engineering by Yizhi Lu December 1991 The thesis of Yizhi Lu is
	ftp://ftp.cse.ucsc.edu//pub/tr/latexed-list-1992-part2.ps.Z, 19930105 1 TECHNICAL REPORTS: JUNE{DECEMBER 1992 University of California at Santa Cruz Baskin Center for Computer Engineering and Information Sciences Santa Cruz, California 95064 U.S.A. UCSC-CRL-92-14 (available electronically as ucsc-crl-92-14.ps.Z) A REPLICATED MONITORING TOOL Darrell D. E. Long August 1992,
	ftp://ftp.cse.ucsc.edu//pub/item/compcon93-final.ps.gz, 19930107 Xtmap: Generate-and-Test Mapper for Table-Lookup Gate Arrays Kevin Karplus Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 (408)459-4250 Internet: karplus@ce.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-04.ps.Z, 19930201 Layer Assignment for Rubber Band Routing Tal Dayan* Wayne Wei-Ming Dai* UCSC-CRL-93-04 January 20 1993 Board of Studies in Computer Engeeniring University of California at Santa Cruz Santa Cruz, CA 95064 EMail: tal@cse.ucsc.edu * This work was supported in part by the National Science Foundation under
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-08.ps.Z, 19930201 University of California Santa Cruz Descriptive Complexity of Optimization and Counting Problems A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Madhukar Narayan Thakur December 1992 The dissertation of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-06.ps.Z, 19930201 SCHEDULING REAL-TIME DISK TRANSFERS FOR CONTINUOUS MEDIA APPLICATIONS Darrell D. E. Long Madhukar N. Thakur Computer and Information Sciences University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-04.ps.Z, 19930201 Layer Assignment for Rubber Band Routing Tal Dayan* Wayne Wei-Ming Dai* UCSC-CRL-93-04 January 20 1993 Board of Studies in Computer Engeeniring University of California at Santa Cruz Santa Cruz, CA 95064 EMail: tal@cse.ucsc.edu * This work was supported in part by the National Science Foundation under
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-08.ps.Z, 19930201 University of California Santa Cruz Descriptive Complexity of Optimization and Counting Problems A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Madhukar Narayan Thakur December 1992 The dissertation of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-07.ps.Z, 19930202 UNIVERSITY OF CALIFORNIA SANTA CRUZ Transparent Remote Procedure Calls A thesis submitted in partial satisfaction of the requirements for the degree of MASTER OF SCIENCE in COMPUTER AND INFORMATION SCIENCE by Michelle Denise Abram December 1992 The thesis of Michelle Denise Abram is approved: Prof.
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-07.ps.Z, 19930202 UNIVERSITY OF CALIFORNIA SANTA CRUZ Transparent Remote Procedure Calls A thesis submitted in partial satisfaction of the requirements for the degree of MASTER OF SCIENCE in COMPUTER AND INFORMATION SCIENCE by Michelle Denise Abram December 1992 The thesis of Michelle Denise Abram is approved: Prof.
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-01.ps.Z, 19930203 Spray Rendering: A New Framework for Visualization Alex Pang and Kyle Smith UCSC-CRL-93-01 January 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 email addresses: pang@cse.ucsc.edu, kyle@cse.ucsc.edu Supported in part by Office of
	ftp://ftp.cse.ucsc.edu//pub/mcmc/MCMCbenchmark93/ftp/Format.ps.Z, 19930322 Input File Format of Coupled Lossy Transmission Lines Element and Model Descriptions for Circuit Simulators (Draft) Jimmy Wang Computer Engineering University of California, Santa Cruz Jan. 31, 1993 1 Introduction This article describes the formats of both the element and model descriptions of
	ftp://ftp.cse.ucsc.edu//pub/protein/tr93.14.ps.Z, 19930414 Massively Parallel Biosequence Analysis Richard Hughey Computer Engineering Board of Studies University of California, Santa Cruz rph@ce.ucsc.edu (408) 459-2939 Technical Report UCSC-CRL-93-14 April 2, 1993
	ftp://ftp.cse.ucsc.edu//pub/qnx/qnx-embed.ps.Z, 19930503 A Microkernel POSIX OS for Realtime Embedded Systems* Dan Hildebrand QNX Software Systems Ltd. 175 Terrence Matthews Kanata, Ontario K2M 1W8 Canada (613) 591-0931 danh@qnx.com
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-14.ps.Z, 19930528 Massively Parallel Biosequence Analysis Richard Hughey Computer Engineering Board of Studies University of California, Santa Cruz rph@ce.ucsc.edu (408) 459-2939 Technical Report UCSC-CRL-93-14 April 2, 1993
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-11.ps.Z, 19930528 Using an object-oriented framework to construct wide-area group communication mechanisms Richard A. Goldingy Vrije Universiteit, Amsterdam, The Netherlands Darrell D. E. Longz University of California, Santa Cruz UCSC CRL 93 11 March 17, 1993 Concurrent Systems Laboratory Computer and Information
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-14.ps.Z, 19930528 Massively Parallel Biosequence Analysis Richard Hughey Computer Engineering Board of Studies University of California, Santa Cruz rph@ce.ucsc.edu (408) 459-2939 Technical Report UCSC-CRL-93-14 April 2, 1993
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-19.ps.gz, 19930528 C++ Classes for the Efficient Manipulation and Storage of Hierarchical Objects Dean R. E. Long UCSC-CRL-93-19 May 27, 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-11.ps.Z, 19930528 Using an object-oriented framework to construct wide-area group communication mechanisms Richard A. Goldingy Vrije Universiteit, Amsterdam, The Netherlands Darrell D. E. Longz University of California, Santa Cruz UCSC CRL 93 11 March 17, 1993 Concurrent Systems Laboratory Computer and Information
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-17.ps.Z, 19930602 Perfect-Balance Planar Clock Routing with Minimal Path Length Qing Zhu Wayne W.M. Dai UCSC-CRL-93-17 supercedes UCSC-CRL-92-12 March 26, 1993 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-20.ps.Z, 19930602 Comparing Two Garbage Collectors for C++ Technical Report UCSC-CRL-93-20 For Electronic Distribution Only Daniel R. Edelson University of California INRIA Project SOR Santa Cruz, CA 95064 F-78153 Rocquencourt Cedex USA France daniel@cse.ucsc.edu edelson@sor.inria.fr 16 Jan 1992
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-20.ps.Z, 19930602 Comparing Two Garbage Collectors for C++ Technical Report UCSC-CRL-93-20 For Electronic Distribution Only Daniel R. Edelson University of California INRIA Project SOR Santa Cruz, CA 95064 F-78153 Rocquencourt Cedex USA France daniel@cse.ucsc.edu edelson@sor.inria.fr 16 Jan 1992
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-18.ps.Z, 19930602 Optimal Sizing of High Speed Clock Networks Based on Distributed RC and Lossy Transmission Line Models Qing Zhu Wayne W.M. Dai Joe G. Xi UCSC-CRL-93-18 April 12, 1993 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-17.ps.Z, 19930602 Perfect-Balance Planar Clock Routing with Minimal Path Length Qing Zhu Wayne W.M. Dai UCSC-CRL-93-17 supercedes UCSC-CRL-92-12 March 26, 1993 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-23.ps.Z, 19930608 Providing Performance Guarantees in an FDDI Network Darrell D. E. Long,y Carol Osterbrockz Computer and Information Sciences University of California, Santa Cruz Luis-Felipe Cabrera Computer Science Department IBM Almaden Research Center
	ftp://ftp.cse.ucsc.edu//pub/rna/techreport.ps.Z, 19930610 Stochastic Context-Free Grammars for Modeling RNA Yasubumi Sakakibaray, Michael Browny, Rebecca C. Underwoody, I. Saira Mianx, David Hausslery UCSC-CRL-93-16 June 8, 1993 y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. email:
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-21.ps.Z, 19930622 Debugging Optimized Code Without Being Misled Max Copperman UCSC-CRL-93-21 June 11, 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 max@cse.ucsc.edu i
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-21.ps.Z, 19930622 Debugging Optimized Code Without Being Misled Max Copperman UCSC-CRL-93-21 June 11, 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 max@cse.ucsc.edu i
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-26.ps.Z, 19930702 Type-Specific Storage Management Daniel Ross Edelson UCSC{CRL{93{26 28 May 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-27.ps.Z, 19930702 Type-Specific Storage Management (Shorter Version) Daniel Ross Edelson UCSC{CRL{93{27 28 May 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-26.ps.Z, 19930702 Type-Specific Storage Management Daniel Ross Edelson UCSC{CRL{93{26 28 May 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-24.ps.Z, 19930706 Debugging Optimized Code Without Being Misled: Currency Determination Max Copperman max@cse.ucsc.edu UCSC-CRL-93-24 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-24.ps.Z, 19930706 Debugging Optimized Code Without Being Misled: Currency Determination Max Copperman max@cse.ucsc.edu UCSC-CRL-93-24 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-91-26.ps.Z, 19930803 Tracking Drifting Concepts By Minimizing Disagreements David P. Helmbold and Philip M. Long UCSC-CRL-91-26 August 1991, revised August 1992 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-31.ps.Z, 19930803 Characterizations of Learnability for Classes of f0; : : : ; ng-valued Functions Shai Ben-David Nicol o Cesa-Bianchiy David Hausslerz Philip M. Longx UCSC-CRL-93-31 August 3, 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-31.ps.Z, 19930803 Characterizations of Learnability for Classes of f0; : : : ; ng-valued Functions Shai Ben-David Nicol o Cesa-Bianchiy David Hausslerz Philip M. Longx UCSC-CRL-93-31 August 3, 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-16.ps.Z, 19930819 Stochastic Context-Free Grammars for Modeling RNA Yasubumi Sakakibaray, Michael Browny, Rebecca C. Underwoody, I. Saira Mianx, David Hausslery UCSC-CRL-93-16 June 8, 1993 y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. email:
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-16.ps.Z, 19930819 Stochastic Context-Free Grammars for Modeling RNA Yasubumi Sakakibaray, Michael Browny, Rebecca C. Underwoody, I. Saira Mianx, David Hausslery UCSC-CRL-93-16 June 8, 1993 y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. email:
	ftp://ftp.cse.ucsc.edu//pub/protein/jmb.part2.ps.Z, 19930910 T(d Ii )2i0m0d1i1m1d2i2m2d3i3m3i4m4m51T(d Id )21T(d Im )21T(m Id )32T(m Ii )32T(m Im )32T(i Id )44T(i Im )44d4T(i Ii )44 Figure 1: The model. 36 HMM 1 BEGIN END HMM 2 HMM w Figure 2: HMM architecture for discovering subfamilies. 37 Model from figure 1BEGINENDm0mN+1IBIEp(1-p)ppp(1-p)(1-p)(1-p) Figure 3:
	ftp://ftp.cse.ucsc.edu//pub/protein/hmm.part1.ps.Z, 19930910 Hidden Markov Models in Computational Biology: Applications to Protein Modeling UCSC-CRL-93-32 Anders Krogh y, Michael Browny, I. Saira Mianx, Kimmen Sj olandery, David Hausslery y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. email:
	ftp://ftp.cse.ucsc.edu//pub/protein/hmm.part2.ps.Z, 19930910 T(d Ii )2i0m0d1i1m1d2i2m2d3i3m3i4m4m51T(d Id )21T(d Im )21T(m Id )32T(m Ii )32T(m Im )32T(i Id )44T(i Im )44d4T(i Ii )44 Figure 1: The model. 36 HMM 1 BEGIN END HMM 2 HMM w Figure 2: HMM architecture for discovering subfamilies. 37 Model from figure 1BEGINENDm0mN+1IBIEp(1-p)ppp(1-p)(1-p)(1-p) Figure 3:
	ftp://ftp.cse.ucsc.edu//pub/protein/jmb.part1.ps.Z, 19930910 Hidden Markov Models in Computational Biology: Applications to Protein Modeling UCSC-CRL-93-32 Anders Krogh y, Michael Browny, I. Saira Mianx, Kimmen Sj olandery, David Hausslery y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. email:
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-25.ps.Z, 19930914 A Study of Undetectable Non-Feedback Shorts for the Purpose of Physical-DFT Richard McGowen F. Joel Ferguson Computer Engineering Department University of California, Santa Cruz Santa Cruz, CA. 95064 UCSC-CRL-93-25 July 11, 1993 Baskin Center for Computer Engineering & Information Sciences University of
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-40.ps.Z, 19930914 University of California Santa Cruz A study of the reliability of hosts on the Internet A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer and Information Sciences by K. B. Sriram June 1993 The thesis of K. B. Sriram is approved: Prof. Darrell
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-25.ps.Z, 19930914 A Study of Undetectable Non-Feedback Shorts for the Purpose of Physical-DFT Richard McGowen F. Joel Ferguson Computer Engineering Department University of California, Santa Cruz Santa Cruz, CA. 95064 UCSC-CRL-93-25 July 11, 1993 Baskin Center for Computer Engineering & Information Sciences University of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-40.ps.Z, 19930914 University of California Santa Cruz A study of the reliability of hosts on the Internet A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer and Information Sciences by K. B. Sriram June 1993 The thesis of K. B. Sriram is approved: Prof. Darrell
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-29.ps.Z, 19930917 A Class of Synchronization Operations that Permit Efficient Race Detection D. P. Helmbold, C. E. McDowell UCSC-CRL-93-29 August 2, 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-30.ps.Z, 19930917 What is a race in a program and when can we detect it D. P. Helmbold, C. E. McDowell UCSC-CRL-93-30 August 2, 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-29.ps.Z, 19930917 A Class of Synchronization Operations that Permit Efficient Race Detection D. P. Helmbold, C. E. McDowell UCSC-CRL-93-29 August 2, 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-32.part1.ps.Z, 19930920 Hidden Markov Models in Computational Biology: Applications to Protein Modeling UCSC-CRL-93-32 Anders Krogh y, Michael Browny, I. Saira Mianx, Kimmen Sj olandery, David Hausslery y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. email:
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-32.part2.ps.Z, 19930920 T(d Ii )2i0m0d1i1m1d2i2m2d3i3m3i4m4m51T(d Id )21T(d Im )21T(m Id )32T(m Ii )32T(m Im )32T(i Id )44T(i Im )44d4T(i Ii )44 Figure 1: The model. 36 HMM 1 BEGIN END HMM 2 HMM w Figure 2: HMM architecture for discovering subfamilies. 37 Model from figure 1BEGINENDm0mN+1IBIEp(1-p)ppp(1-p)(1-p)(1-p) Figure 3:
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-32.part1.ps.Z, 19930920 Hidden Markov Models in Computational Biology: Applications to Protein Modeling UCSC-CRL-93-32 Anders Krogh y, Michael Browny, I. Saira Mianx, Kimmen Sjolandery, David Hausslery y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. email:
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-10.ps.Z, 19930923 Logical Definability of NP Optimization Problems Phokion G. Kolaitis Madhukar N. Thakury UCSC-CRL-93-10z Computer and Information Sciences University of California Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-10.ps.Z, 19930923 Logical Definability of NP Optimization Problems Phokion G. Kolaitis Madhukar N. Thakury UCSC-CRL-93-10z Computer and Information Sciences University of California Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-34.ps.Z, 19930924 1 REINAS: Real-Time Environmental Information Network and Analysis System: Phase II Requirements Definition P.E. Mantey, J.J Garcia-Luna, H.G. Kolsky, D.D.E. Long, A.T. Pang, E.C. Rosen, C. Tang, B.R. Montague, M.D. Abram, W.W. Macy, B.R. Gritton (MBARI), J. Paduan, W. Nuss (NPS) UCSC-CRL-93-34 July 26,
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-34.ps.Z, 19930924 1 REINAS: Real-Time Environmental Information Network and Analysis System: Phase II Requirements Definition P.E. Mantey, J.J Garcia-Luna, H.G. Kolsky, D.D.E. Long, A.T. Pang, E.C. Rosen, C. Tang, B.R. Montague, M.D. Abram, W.W. Macy, B.R. Gritton (MBARI), J. Paduan, W. Nuss (NPS) UCSC-CRL-93-34 July 26,
	ftp://ftp.cse.ucsc.edu//pub/rna/hawaii94.ps.Z, 19930929 Stochastic Context-Free Grammars for Modeling RNA Yasubumi Sakakibarayz, Michael Browny, Rebecca C. Underwoody, I. Saira Mianx, David Hausslery y Computer and Information Sciences x Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA. z present address: ISIS, Fujitsu Labs Ltd.,
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-09.ps.Z, 19931006 Modeling replica divergence in a weak-consistency protocol for global-scale distributed data bases Richard A. Goldingy Vrije Universiteit, Amsterdam, The Netherlands Darrell D. E. Longz University of California, Santa Cruz UCSC CRL 93 09 Concurrent Systems Laboratory Computer and Information Sciences
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-03.ps.Z, 19931012 The Swift/RAID Distributed Transaction Driver Bruce R. Montague UCSC-CRL-93-03 1 January 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-03.ps.Z, 19931012 The Swift/RAID Distributed Transaction Driver Bruce R. Montague UCSC-CRL-93-03 1 January 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-02.ps.Z, 19931014 Rapid Exploration of Curvilinear Grids Using Direct Volume Rendering Allen Van Gelder and Jane Wilhelms Computer and Information Sciences University of California, Santa Cruz 95064 UCSC-CRL-93-02 October 14, 1993
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-36.ps.Z, 19931117 Worst-case Quadratic Loss Bounds for On-line Prediction of Linear Functions by Gradient Descent Nicol o Cesa-Bianchi Philip M. Longy Manfred K. Warmuthz UCSC-CRL-93-36 October 12, 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-35.ps.Z, 19931117 1 Extracting Time-of-Flight Delay from Scattering Parameter Based Macromodel Haifang Liao and Wayne Wei-Ming Dai UCSC-CRL-93-35 Aug. 29, 1993 Board of Studies in Computer Engineering University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-36.ps.Z, 19931117 Worst-case Quadratic Loss Bounds for On-line Prediction of Linear Functions by Gradient Descent Nicol o Cesa-Bianchi Philip M. Longy Manfred K. Warmuthz UCSC-CRL-93-36 October 12, 1993 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-45.ps.Z, 19931209 Hierarchical Clock Routing Scheme for Multi-Chip Modules Based on Area Pad Interconnection Qing Zhu Wayne W.M. Dai UCSC-CRL-93-45 Oct. 10, 1993 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-46.ps.Z, 19931209 Delay Bounded Minimum Steiner Tree Algorithms for Performance-Driven Routing Qing Zhu Wayne W.M. Dai UCSC-CRL-93-46 Oct. 10, 1993 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-39.ps.Z, 19931209 TOWARDS DOMAIN-INDEPENDENT MACHINE INTELLIGENCE Robert Levinson UCSC-CRL-93-39 November 4, 1993 Department of Computer and Information Sciences University of California Santa Cruz Santa Cruz, CA 95064 U.S.A Phone: 408-459-2097 FAX: 408-459-4829 E-mail: levinson@cis.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-46.ps.Z, 19931209 Delay Bounded Minimum Steiner Tree Algorithms for Performance-Driven Routing Qing Zhu Wayne W.M. Dai UCSC-CRL-93-46 Oct. 10, 1993 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-48.ps.Z, 19931214 Elimination of Undetectable Shorts During Channel Routing Richard McGowen F. Joel Ferguson UCSC-CRL-93-48 November 15, 1993 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-44.ps.Z, 19931221 1 Transient Analysis of Interconnects with Nonlinear Driver Using Mixed Exponential Function Approximation Haifang Liao, Rui Wang1 and Wayne Wei-Ming Dai UCSC-CRL-93-44 Oct.8, 1993 Board of Studies in Computer Engineering University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-47.ps.Z, 19940103 University of California Santa Cruz Scalable Parallel Direct Volume Rendering for Nonrectilinear Computational Grids A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Science by Judith Ann Challinger December 1993 The
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-47.ps.Z, 19940103 University of California Santa Cruz Scalable Parallel Direct Volume Rendering for Nonrectilinear Computational Grids A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Science by Judith Ann Challinger December 1993 The
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-43.ps.Z, 19940103 Optimal Design of Self-Damped Lossy Transmission Lines for Multichip Modules Jimmy Shinn-Hwa Wang Dr. Wayne Wei-Ming Dai UCSC-CRL-93-43 8 October 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-51.ps.Z, 19940104 Learning Binary Relations Using Weighted Majority Voting Sally A. Goldman Manfred K. Warmuthy UCSC-CRL-93-51 December 29, 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-06.ps.Z, 19940128 Swift/RAID: A Distributed RAID System Darrell D. E. Long, Bruce R. Montaguey Computer and Information Sciences University of California, Santa Cruz Luis-Felipe Cabrera Computer Science Department IBM Almaden Research Center
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-37.ps.Z, 19940128 University of California Santa Cruz Data filtering and distribution modeling algorithms for machine learning A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Yoav Freund September 1993 The dissertation of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-06.ps.Z, 19940128 Swift/RAID: A Distributed RAID System Darrell D. E. Long, Bruce R. Montaguey Computer and Information Sciences University of California, Santa Cruz Luis-Felipe Cabrera Computer Science Department IBM Almaden Research Center
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-37.ps.Z, 19940128 University of California Santa Cruz Data filtering and distribution modeling algorithms for machine learning A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Yoav Freund September 1993 The dissertation of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-07.ps.Z, 19940214 have adopted the leaky bucket mechanism to satisfy the application required quality of service parameters. The basic performance metrics such as the delay, delay jitter, and system utilization are evaluated using simulations. This study indicates that source characterization is essential for the PCC
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-22.ps.Z, 19940216 Doing it with Mirrors: Low Budget Stereo Graphics Allen Van Gelder and Jane Wilhelms UCSC-CRL-93-22 Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 Jan. 7, 1994 (rev.)
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-22.ps.Z, 19940216 Doing it with Mirrors: Low Budget Stereo Graphics Allen Van Gelder and Jane Wilhelms UCSC-CRL-93-22 Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 Jan. 7, 1994 (rev.)
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-49.ps.Z, 19940216 University of California Santa Cruz Automated Termination Analysis for Logic Programs A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Kirack Sohn December 1993 The dissertation of Kirack Sohn is approved:
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-49.ps.Z, 19940216 University of California Santa Cruz Automated Termination Analysis for Logic Programs A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Kirack Sohn December 1993 The dissertation of Kirack Sohn is approved:
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-02.ps.Z, 19940218 Multi-Dimensional Trees for Controlled Volume Rendering and Compression Jane Wilhelms and Allen Van Gelder UCSC-CRL-94-02 Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 wilhelms@cs.ucsc.edu avg@cs.ucsc.edu Jan. 21, 1994 (rev.)
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-50.ps.Z, 19940222 Simulating Network Traffic In An Associative Processing Environment Claude S Noshpitz UCSC-CRL-93-50 7 December 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-13.ps.Z, 19940301 Sample compression, learnability, and the Vapnik-Chervonenkis dimension. Sally Floyd Manfred Warmuthy UCSC-CRL-93-13 March 30, 1993 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/amoeba/orca_papers/europen91.ps.Z, 19940320 A COMPARATIVE STUDY OF FIVE PARALLEL PROGRAMMING LANGUAGES Henri E. Bal Dept. of Mathematics and Computer Science Vrije Universiteit Amsterdam bal@cs.vu.nl
	ftp://ftp.cse.ucsc.edu/pub/amoeba/amoeba_papers/group.ps.Z, 19940320 EFFICIENT RELIABLE GROUP COMMUNICATION FOR DISTRIBUTED SYSTEMS M. Frans Kaashoek M.I.T. Laboratory for Computer Science Cambridge, MA Andrew S. Tanenbaum Dept. of Math and Comp. Science Vrije Universiteit Amsterdam, The Netherlands
	ftp://ftp.cse.ucsc.edu/pub/amoeba/orca_papers/europen91.ps.Z, 19940320 A COMPARATIVE STUDY OF FIVE PARALLEL PROGRAMMING LANGUAGES Henri E. Bal Dept. of Mathematics and Computer Science Vrije Universiteit Amsterdam bal@cs.vu.nl
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/spe89.ps.Z, 19940320 The Performance Of The Amoeba Distributed Operating System ROBBERT VAN RENESSE, HANSVAN STAVEREN ANDANDREW S. TANENBAUM Dept. of Mathematics and Computer Science, Vrije Universiteit, Amsterdam, The Netherlands SUMMARY Amoeba is a capability-based distributed operating system designed for high
	ftp://ftp.cse.ucsc.edu/pub/amoeba/amoeba_papers/scm89.ps.Z, 19940320 On the design of the Amoeba Configuration Manager Erik H. Baalbergen Kees Verstoep Andrew S. Tanenbaum Vrije Universiteit Amsterdam, The Netherlands
	ftp://ftp.cse.ucsc.edu//pub/amoeba/orca_papers/sedms93.ps.Z, 19940320 Panda: A Portable Platform to Support Parallel Programming Languages Raoul Bhoedjang Tim R uhl Rutger Hofman Koen Langendoen Henri Bal Vrije Universiteit Amsterdam Department of Mathematics and Computer Science Frans Kaashoek MIT Laboratory for Computer Science, Cambridge MA June 21, 1993
	ftp://ftp.cse.ucsc.edu//pub/amoeba/orca_papers/tse92.ps.Z, 19940320 ORCA: ALANGUAGE FOR PARALLEL PROGRAMMING OF DISTRIBUTED SYSTEMS Henri E. Bal * M. Frans Kaashoek Andrew S. Tanenbaum Dept. of Mathematics and Computer Science Vrije Universiteit Amsterdam, The Netherlands
	ftp://ftp.cse.ucsc.edu/pub/amoeba/amoeba_papers/sigops92.ps.Z, 19940320 A COMPARISON OF TWO PARADIGMS FOR DISTRIBUTED COMPUTING M. Frans Kaashoek Andrew S. Tanenbaum Kees Verstoep
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/cs91.ps.Z, 19940320 A Comparison of Two Distributed Systems: Amoeba and Sprite Fred Douglis douglis@mitl.com Matsushita Information Technology Laboratory 182 Nassau Street Princeton, NJ 08542 USA M. Frans Kaashoek kaashoek@cs.vu.nl Dept. of Math and Computer Science Vrije Universiteit
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/group.ps.Z, 19940320 EFFICIENT RELIABLE GROUP COMMUNICATION FOR DISTRIBUTED SYSTEMS M. Frans Kaashoek M.I.T. Laboratory for Computer Science Cambridge, MA Andrew S. Tanenbaum Dept. of Math and Comp. Science Vrije Universiteit Amsterdam, The Netherlands
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/scm89.ps.Z, 19940320 On the design of the Amoeba Configuration Manager Erik H. Baalbergen Kees Verstoep Andrew S. Tanenbaum Vrije Universiteit Amsterdam, The Netherlands
	ftp://ftp.cse.ucsc.edu//pub/amoeba/orca_papers/sedms92.ps.Z, 19940320 TRANSPARENT FAULT-TOLERANCE IN PARALLEL ORCA PROGRAMS M. Frans Kaashoek (kaashoek@cs.vu.nl) Raymond Michiels (raymond@cs.vu.nl) Henri E. Bal (bal@cs.vu.nl) Andrew S. Tanenbaum (ast@cs.vu.nl) Vrije Universiteit, Amsterdam The Netherlands
	ftp://ftp.cse.ucsc.edu/pub/amoeba/amoeba_papers/cacm90.ps.Z, 19940320 Experiences with the Amoeba Distributed Operating System Andrew S. Tanenbaum Robbert van Renesse1 Hans van Staveren Gregory J. Sharp Dept. of Mathematics and Computer Science Vrije Universiteit De Boelelaan 1081 1081 HV Amsterdam, The Netherlands Internet: ast@cs.vu.nl, cogito@cs.vu.nl, sater@cs.vu.nl,
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/dse93.ps.Z, 19940320 GROUP COMMUNICATION IN AMOEBA AND ITS APPLICATIONS M. Frans Kaashoek M.I.T. Laboratory for Computer Science Cambridge, MA Andrew S. Tanenbaum Kees Verstoep Dept. of Math. and Comp. Sci. Vrije Universiteit Amsterdam, The Netherlands Email: kaashoek@lcs.mit.edu, ast@cs.vu.nl, and versto@cs.vu.nl.
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/cacm90.ps.Z, 19940320 Experiences with the Amoeba Distributed Operating System Andrew S. Tanenbaum Robbert van Renesse1 Hans van Staveren Gregory J. Sharp Dept. of Mathematics and Computer Science Vrije Universiteit De Boelelaan 1081 1081 HV Amsterdam, The Netherlands Internet: ast@cs.vu.nl, cogito@cs.vu.nl, sater@cs.vu.nl,
	ftp://ftp.cse.ucsc.edu//pub/amoeba/orca_papers/oopsla93.ps.Z, 19940320 Object Distribution in Orca using Compile-Time and Run-Time Techniques Henri E. Bal1 Vrije Universiteit Dept. of Mathematics and Computer Science Amsterdam, The Netherlands bal@cs.vu.nl M. Frans Kaashoek2 M.I.T. Laboratory for Computer Science Cambridge, MA kaashoek@lcs.mit.edu
	ftp://ftp.cse.ucsc.edu//pub/amoeba/orca_papers/ieee92.ps.Z, 19940320 PARALLEL PROGRAMMING USING SHARED OBJECTS AND BROADCASTING Andrew S. Tanenbaum M. Frans Kaashoek Henri E. Bal Dept. of Mathematics and Computer Science Vrije Universiteit Amsterdam, The Netherlands
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/sigops92.ps.Z, 19940320 A COMPARISON OF TWO PARADIGMS FOR DISTRIBUTED COMPUTING M. Frans Kaashoek Andrew S. Tanenbaum Kees Verstoep
	ftp://ftp.cse.ucsc.edu/pub/amoeba/amoeba_papers/dcs86.ps.Z, 19940320 Using Sparse Capabilities in a Distributed Operating System Andrew S. Tanenbaum Dept. of Mathematics and Computer Science Vrije Universiteit Amsterdam, The Netherlands Sape J. Mullender Centre for Mathematics and Computer Science Amsterdam, The Netherlands Robbert van Renesse Dept. of Mathematics and
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/dcs93.ps.Z, 19940320 Using Group Communication to Implement a Fault-Tolerant Directory Service M. Frans Kaashoek Andrew S. Tanenbaum Kees Verstoep Dept. of Mathematics and Computer Science Vrije Universiteit Amsterdam, The Netherlands Email: kaashoek@lcs.mit.edu, ast@cs.vu.nl, and versto@cs.vu.nl.
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/comcom91.ps.Z, 19940320 THE AMOEBA DISTRIBUTED OPERATING SYSTEM A STATUS REPORT Andrew S. Tanenbaum M. Frans Kaashoek Robbert van Renesse Henri E. Bal Dept. of Mathematics and Computer Science Vrije Universiteit Amsterdam, The Netherlands
	ftp://ftp.cse.ucsc.edu//pub/amoeba/orca_papers/cpe92.ps.Z, 19940320 REPLICATION TECHNIQUES FOR SPEEDING UP PARALLEL APPLICATIONS ON DISTRIBUTED SYSTEMS Henri E. Bal * M. Frans Kaashoek Andrew S. Tanenbaum Dept. of Mathematics and Computer Science Vrije Universiteit De Boelelaan 1081a 1081 HV Amsterdam The Netherlands Jack Jansen Centrum voor Wiskunde en Informatica
	ftp://ftp.cse.ucsc.edu/pub/amoeba/orca_papers/sedms93.ps.Z, 19940320 Panda: A Portable Platform to Support Parallel Programming Languages Raoul Bhoedjang Tim Ruhl Rutger Hofman Koen Langendoen Henri Bal Vrije Universiteit Amsterdam Department of Mathematics and Computer Science Frans Kaashoek MIT Laboratory for Computer Science, Cambridge MA June 21, 1993
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/dcs86.ps.Z, 19940320 Using Sparse Capabilities in a Distributed Operating System Andrew S. Tanenbaum Dept. of Mathematics and Computer Science Vrije Universiteit Amsterdam, The Netherlands Sape J. Mullender Centre for Mathematics and Computer Science Amsterdam, The Netherlands Robbert van Renesse Dept. of Mathematics and
	ftp://ftp.cse.ucsc.edu//pub/amoeba/amoeba_papers/tocs93.ps.Z, 19940320 FLIP: an Internetwork Protocol for Supporting Distributed Systems M. Frans Kaashoek Robbert van Renesse* Hans van Staveren Andrew S. Tanenbaum Vrije Universiteit Amsterdam, The Netherlands
	ftp://ftp.cse.ucsc.edu/pub/amoeba/manuals/sys.ps.Z, 19940412 The Amoeba Reference Manual System Administration Guide AMOEBA Amoeba is a registered trademark of the Vrije Universiteit in some countries. AMOEBA is a trademark of the Vrije Universiteit. Sun-3, Sun-4, NFS, SPARCclassic, SPARCstation, SunOS and Solaris" are trademarks of Sun Microsystems, Inc. SPARC
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-01.ps.Z, 19940413 Classifying Networks: When Can Two Anonymous Networks Compute The Same Vector-Valued Functions Nancy E. Norris UCSC-CRL-94-01 March 30, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-01.ps.Z, 19940413 Classifying Networks: When Can Two Anonymous Networks Compute The Same Vector-Valued Functions Nancy E. Norris UCSC-CRL-94-01 March 30, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-09.ps.Z, 19940414 Transient Analysis of Coupled Transmission Lines Using Scattering Parameter Based Macromodel Jimmy Shinn-Hwa Wang Dr. Wayne Wei-Ming Dai UCSC-CRL-94-09 11 April 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/refdbms/usenix-paper.ps, 19940419 Biographies Richard A. Golding received his B.S. degree in Computer Science from Western Washington University in 1987. He received his M.S. degree in 1991 and his Ph.D. degree in 1992, both in Computer and Information Sciences from the University of California, Santa Cruz. He is currently a researcher
	ftp://ftp.cse.ucsc.edu//pub/amoeba/orca_papers/spe92.ps.Z, 19940420 A COMPARISON OF TWO PARADIGMS FOR DISTRIBUTED SHARED MEMORY Willem G. Levelt M. Frans Kaashoek Henri E. Bal Andrew S. Tanenbaum Department of Mathematics and Computer Science Vrije Universiteit De Boelelaan 1081a, 1081 HV Amsterdam, The Netherlands
	ftp://ftp.cse.ucsc.edu//pub/rna/scfg.ps.Z, 19940426 Stochastic Context-Free Grammars for tRNA Modeling Yasubumi Sakakibara y, Michael Browny, Richard Hugheyz, I. Saira Mianx, Kimmen Sj olandery, Rebecca C. Underwoody, David Hausslery y Computer and Information Sciences z Computer Engineering x Sinsheimer Laboratories University of California, Santa Cruz,
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-17.ps.Z, 19940426 Poor Man's Watchpoints Max Copperman Jeff Thomas UCSC-CRL-94-17 April 26, 1994 Max Copperman Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Jeff Thomas Kubota Pacific Computer, Inc. 2630 Walsh Avenue Santa Clara, CA 95051-0905 This work
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-17.ps.Z, 19940426 Poor Man's Watchpoints Max Copperman Jeff Thomas UCSC-CRL-94-17 April 26, 1994 Max Copperman Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Jeff Thomas Kubota Pacific Computer, Inc. 2630 Walsh Avenue Santa Clara, CA 95051-0905 This work
	ftp://ftp.cse.ucsc.edu//pub/rna/techreport.crl94.14.ps.Z, 19940504 The Application of Stochastic Context-Free Grammars to Folding, Aligning and Modeling Homologous RNA Sequences Yasubumi Sakakibara y, Michael Browny, Richard Hugheyz, I. Saira Mianx, Kimmen Sj olandery, Rebecca C. Underwoody, David Hausslery y Computer and Information Sciences z Computer Engineering x
	ftp://ftp.cse.ucsc.edu//pub/qnx/qnx-pen.ps.Z, 19940509 QNXfi: Microkernel Technology for Open Systems Handheld Computing Dan Hildebrand QNX Software Systems Ltd. 175 Terence Matthews Crescent Kanata, Ontario K2M 1W8 Canada (613) 591-0931 danh@qnx.com
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-14.ps.Z, 19940513 The Application of Stochastic Context-Free Grammars to Folding, Aligning and Modeling Homologous RNA Sequences Yasubumi Sakakibara y, Michael Browny, Richard Hugheyz, I. Saira Mianx, Kimmen Sjolandery, Rebecca C. Underwoody, David Hausslery y Computer and Information Sciences z Computer Engineering x
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-08.ps.Z, 19940513 1 REINAS: Real-Time Environmental Information Network and Analysis System: Phase III - SYSTEMS DESIGN P.E. Mantey, D.D.E. Long,J.J. Garcia-Luna, A.T. Pang, H.G. Kolsky (UCSC), B.R. Gritton (MBARI), W.A. Nuss (NPS) UCSC-CRL-94-08 March 10, 1994 Baskin Center for Computer Engineering and Information
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-14.ps.Z, 19940513 The Application of Stochastic Context-Free Grammars to Folding, Aligning and Modeling Homologous RNA Sequences Yasubumi Sakakibara y, Michael Browny, Richard Hugheyz, I. Saira Mianx, Kimmen Sj olandery, Rebecca C. Underwoody, David Hausslery y Computer and Information Sciences z Computer Engineering x
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-08.ps.Z, 19940513 1 REINAS: Real-Time Environmental Information Network and Analysis System: Phase III - SYSTEMS DESIGN P.E. Mantey, D.D.E. Long,J.J. Garcia-Luna, A.T. Pang, H.G. Kolsky (UCSC), B.R. Gritton (MBARI), W.A. Nuss (NPS) UCSC-CRL-94-08 March 10, 1994 Baskin Center for Computer Engineering and Information
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-18.ps.Z, 19940516 A Field-Programmable Prototyping Board: XC4000 BORG User's Guide Pak K. Chan UCSC-CRL-94-18 April 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tcos/v7n1/peace.ps, 19940531 PEACE German National Research Center for Computer Science GMD FIRST at the Technical University of Berlin Hardenbergplatz 2, 1000 Berlin 12, FRG Personnel Principal Investigator Wolfgang Schr oder Preikschat wosch@first.gmd.de Friedrich Sch on fs@first.gmd.de Researchers Ralph Berg ralph@first.gmd.de J
	ftp://ftp.cse.ucsc.edu//pub/tcos/v7n1/cover.ps, 19940531 IEEE Computer Society Technical Committee on Operating Systems and Application Environments Newsletter Autumn 1993 Contents i Who's who in the TCOS ii Chair's and Editor's messages iii WWOS-IV proceedings Calls for Papers 1 OSP an environment for operating system projects Michael Kifer and Scott A.
	ftp://ftp.cse.ucsc.edu//pub/tcos/v7n1/wwos.ps, 19940531 WWOS-IV Workshop Summary Fred Douglis (Matsushita Information Technology Lab.) Dinesh Kulkarni (Univ. of Notre Dame) Ravindra Kuramkote (Univ. of Utah) Bruce Montague (Univ. of California, Santa Cruz) Madhusudhan Talluri (Univ. of Wisconsin) 1 Introduction The 4th Workshop on Workstation Operating
	ftp://ftp.cse.ucsc.edu//pub/tcos/v7n1/mjs.ps, 19940531 Syst emes d'Objets R epartis Project Description and Bibliography Update of 9 November 1993 Syst emes d'Objets R epartis (Distributed Object-Support Systems) INRIA (Institut National de Recherche en Informatique et Automatique) B.P. 105 Rocquencourt 78153 Le Chesnay Cedex, France tel. +33 (1)
	ftp://ftp.cse.ucsc.edu//pub/tcos/v7n1/frontmatter.ps, 19940531 Technical Committee on Operating Systems and Application Environments Newsletter Chair Prof. Darrell D. E. Long Computer and Information Sciences Applied Sciences Building University of California Santa Cruz, CA 95064 darrell@cis.ucsc.edu Vice-chair for Operating System Structures Prof. Brian Bershad
	ftp://ftp.cse.ucsc.edu//pub/tcos/v7n1/osp.ps, 19940531 OSP An Environment for Operating System Projects Michael Kifer and Scott A. Smolka Department of Computer Science SUNY at Stony Brook Stony Brook, NY 11794-4400 fkifer,sasg@cs.sunysb.edu 1 Introduction OSP is both an implementation of a modern operating system, and a flexible environment for generating
	ftp://ftp.cse.ucsc.edu//pub/borg/ACME/marcelo.ps.Z, 19940604 University of California Santa Cruz A Reconfigurable Hardware Accelerator for Back-Propagation Connectionist Classifiers A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Engineering by Marcelo H. Mart n June 1994 The thesis of Marcelo H. Mart
	ftp://ftp.cse.ucsc.edu//pub/borg/ACME/aaronf.ps.Z, 19940604 University of California Santa Cruz ACME: A Field-Programmable Gate Array Implementation of a Self-Adapting and Scalable Connectionist Network A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Engineering by Aaron T. Ferrucci March 1994 The
	ftp://ftp.cse.ucsc.edu//pub/rna/gibbs.ps.Z, 19940609 RNA Modeling Using Gibbs Sampling and Stochastic Context Free Grammars Leslie Grate and Mark Herbster and Richard Hughey and David Haussler Baskin Center for Computer Engineering and Computer and Information Sciences University of California Santa Cruz, CA 95064 I. Saira Mian and Harry Noller Sinsheimer
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-38.ps.Z, 19940610 Exploiting the Physics of State-Space Search Robert Levinson UCSC-CRL-93-38 June 10, 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Email: levinson@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-15.ps.Z, 19940610 UDS: A Universal Data Structure Robert Levinson UCSC-CRL-94-15 June 10, 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 (408)459-2087 FAX: (408)459-4829 E-mail: levinson@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-38.ps.Z, 19940610 Exploiting the Physics of State-Space Search Robert Levinson UCSC-CRL-93-38 June 10, 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Email: levinson@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/rna/techrep.snRNA.94-23.ps.gz, 19940610 Stochastic Context-Free Grammars for Modeling Three Spliceosomal Small Nuclear Ribonucleic Acids Rebecca Christine Underwood UCSC-CRL-94-23 June 9, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-22.ps.Z, 19940610 Morph II: A Universal Agent: Progress Report and Proposal Robert Levinson UCSC-CRL-94-22 June 10, 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 levinson@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-10.ps.Z, 19940613 A Pattern-Weight Formulation of Search Knowledge Robert Levinson Gil Fuchs UCSC-CRL-94-10 supersedes UCSC-CRL-89-22 and UCSC-CRL-91-15 February 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 (408)459-2087 ARPANET:levinson@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-10.ps.Z, 19940613 A Pattern-Weight Formulation of Search Knowledge Robert Levinson Gil Fuchs UCSC-CRL-94-10 supersedes UCSC-CRL-89-22 and UCSC-CRL-91-15 February 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 (408)459-2087 ARPANET:levinson@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-20.ps.Z, 19940620 Carafe User's Manual Release Alpha.4 Alvin Jee Cyrus Bazeghi UCSC-CRL-94-20 June 13, 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Copyright c Regents of the University of California
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-20.ps.Z, 19940620 Carafe User's Manual Release Alpha.4 Alvin Jee Cyrus Bazeghi UCSC-CRL-94-20 June 13, 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Copyright c Regents of the University of California
	ftp://ftp.cse.ucsc.edu//pub/ml/ucsc-crl-94-16.ps.Z, 19940622 Exponentiated Gradient Versus Gradient Descent for Linear Predictors Jyrki Kivinen Manfred K. Warmuth UCSC-CRL-94-16 June 21, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-25.ps.Z, 19940622 Unsupervised learning of distributions on binary vectors using two layer networks Yoav Freund David Haussler UCSC-CRL-94-25 June 22, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/prs93.ps.Z, 19940630 Fig. 3 Volume Transforms in Parallel Fig. 4 Data with Ramp to Show Noise Fig. 5 8X magnification Zero Order Hold Fig. 6 8X Magnification Trilinear . Our implementation on the MasPar allows rendering with changing viewpoints of five frames/second and two frames/sec- ond for higher quality trilinear
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-19.ps.Z, 19940705 Direct Volume Rendering via 3D Textures Orion Wilson, Allen Van Gelder, Jane Wilhelms Computer and Information Sciences University of California, Santa Cruz UCSC-CRL-94-19 Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 moria@cs.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-19.ps.Z, 19940705 Direct Volume Rendering via 3D Textures Orion Wilson, Allen Van Gelder, Jane Wilhelms Computer and Information Sciences University of California, Santa Cruz UCSC-CRL-94-19 Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 moria@cs.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/WarpJPDC.ps.Z, 19940706 2D and 3D Optimal Parallel Image Warping Craig M. Wittenbrink Arun K. Somani Dept. of Electrical Engineering Dept. of Electrical Engineering, University of Washington Dept. of Computer Science and Seattle, WA 98195 Engineering University of Washington Seattle, WA 98195, USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/generate.ps.Z, 19940719 Cache Write Generate For High-Performance Processing Craig M. Wittenbrink !, Arun K. Somani, and Chung-Ho Chen Department of Electrical Engineering and Department of Computer Science and Engineering University of Washington, FT-10 Seattle, Washington 98195 Telephone: Arun K. Somani: (206) 685-1602
	ftp://ftp.cse.ucsc.edu//pub/reinas/mixmatch/paper.ps.Z, 19940723 Mix&Match: A Construction Kit for Visualization Alex Pang and Naim Alper Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/mixmatch/plate.ps.Z, 19940723 Figure 1: A spart that produces contours and pseudocolor mapping of the cut plane of a humidity field. Figure 3: A spart that fuses 4 input streams: geopotential height, temperature, humidity and wind field. Figure 5: This spart maps wind directions to surface normals. Vorticity is used to color the
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-33.ps.Z, 19940725 A Hidden Markov Model that finds genes in E. coli DNA Anders Krogh Electronics Institute Build. 349, Technical University of Denmark, 2800 Lyngby, Denmark email: krogh@nordig.ei.dth.dk I. Saira Mian Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA email: saira@fangio.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-33.ps.Z, 19940725 A Hidden Markov Model that finds genes in E. coli DNA Anders Krogh Electronics Institute Build. 349, Technical University of Denmark, 2800 Lyngby, Denmark email: krogh@nordig.ei.dth.dk I. Saira Mian Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA email: saira@fangio.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/dna/stormo.ps.Z, 19940725 Optimally Parsing a Sequence into Different Classes Based on Multiple Types of Evidence Gary D. Stormo1 and David Haussler2 1 Dept. of Molecular, Cellular and Developmental Biology University of Colorado, Boulder, CO 80309-0347 phone: 303-492-1476, FAX: 303-492-7744 stormo@beagle.colorado.edu 2 Dept. of
	ftp://ftp.cse.ucsc.edu//pub/dna/ucsc-crl-93-33.ps.Z, 19940725 A Hidden Markov Model that finds genes in E. coli DNA Anders Krogh Electronics Institute Build. 349, Technical University of Denmark, 2800 Lyngby, Denmark email: krogh@nordig.ei.dth.dk I. Saira Mian Sinsheimer Laboratories University of California, Santa Cruz, CA 95064, USA email: saira@fangio.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-28.ps.Z, 19940727 1 Scattering Parameter Transient Analysis of Interconnect Networks with Nonlinear Terminations Using Recursive Convolution Haifang Liao and Wayne Wei-Ming Dai UCSC-CRL-93-28 June 28, 1993 Board of Studies in Computer Engineering University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/dna/ucsc-crl-94-24.ps.gz, 19940731 Using Markov Models and Hidden Markov Models to Find Repetitive Extragenic Palindromic Sequences in Escherichia coli Kevin Karplus UCSC-CRL-94-24 26 July 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 karplus@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/rna/cpm94.ps.Z, 19940801 Recent Methods for RNA Modeling Using Stochastic Context-Free Grammars Yasubumi Sakakibara1 , Michael Brown1, Richard Hughey2, I. Saira Mian3, Kimmen Sj olander1, Rebecca C. Underwood1, David Haussler1 1 Computer and Information Sciences 2 Computer Engineering 3 Sinsheimer Laboratories University of
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-24.ps.Z, 19940809 Using Markov Models and Hidden Markov Models to Find Repetitive Extragenic Palindromic Sequences in Escherichia coli Kevin Karplus UCSC-CRL-94-24 26 July 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 karplus@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-23.ps.Z, 19940809 Stochastic Context-Free Grammars for Modeling Three Spliceosomal Small Nuclear Ribonucleic Acids Rebecca Christine Underwood UCSC-CRL-94-23 June 9, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-23.ps.Z, 19940809 Stochastic Context-Free Grammars for Modeling Three Spliceosomal Small Nuclear Ribonucleic Acids Rebecca Christine Underwood UCSC-CRL-94-23 June 9, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-28.ps.Z, 19940809 On-line Prediction and Conversion Strategies N. Cesa-Bianchi Y. Freundy D.P. Helmboldz M. Warmuthx UCSC-CRL-94-28 August 9, 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-24.ps.Z, 19940809 Using Markov Models and Hidden Markov Models to Find Repetitive Extragenic Palindromic Sequences in Escherichia coli Kevin Karplus UCSC-CRL-94-24 26 July 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 karplus@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-27.ps.Z, 19940809 Computer Sculpting of Polygonal Models using Virtual Tools James R. Bill Suresh K. Lodha UCSC-CRL-94-27 22 July 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-26.ps.Z, 19940812 University of California Santa Cruz Rectangle Replacement and Variable Ordering: Two Techniques for Logic Minimization Using If-Then-Else DAGs A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer Engineering by Soren Soe June 1994 The
	ftp://ftp.cse.ucsc.edu//pub/rna/scfgrev.ps.gz, 19940812 1 Stochastic Context-Free Grammars for tRNA Modeling Yasubumi Sakakibara y, Michael Browny, Richard Hugheyz, I. Saira Mianx, Kimmen Sj olandery, Rebecca C. Underwoody, David Hausslery y Computer and Information Sciences z Computer Engineering x Sinsheimer Laboratories University of California, Santa
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-34.ps.Z, 19940929 A taxonomy of race conditions. D. P. Helmbold, C. E. McDowell UCSC-CRL-94-34 September 28, 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-34.ps.Z, 19940929 A taxonomy of race conditions. D. P. Helmbold, C. E. McDowell UCSC-CRL-94-34 September 28, 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-35.ps.Z, 19940929 A taxonomy of race detection algorithms. D. P. Helmbold, C. E. McDowell UCSC-CRL-94-35 September 28, 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-35.ps.Z, 19940929 A taxonomy of race detection algorithms. D. P. Helmbold, C. E. McDowell UCSC-CRL-94-35 September 28, 1994 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-31.ps.Z, 19941024 Topological Considerations in Isosurface Generation UCSC-CRL-94-31 Allen Van Gelder and Jane Wilhelms Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz June 11, 1994
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-40.ps.Z, 19941024 References 21 References V.H. Champac, A. Rubio, and J. Figueras. Electrical model of the floating gate defect in CMOS IC's: Implications on IDDQ testing. IEEE Transactions on Computer-Aided Design, pages 35969, March 1994. H. Cox and J. Rajski. Stuck-open and transition fault testing in CMOS
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-38.ps.Z, 19941024 University of California Santa Cruz Analysis and Transformation of Logic Programs A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Kjell Erik Post December 1994 The dissertation of Kjell Erik Post is
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-41.ps.Z, 19941024 Selective Victim Caching: A Method to Improve the Performance of Direct-Mapped Caches Dimitrios Stiliadis Anujan Varma UCSC-CRL-93-41 October 6, 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Research supported by NSF Young Investigator Award
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-31.ps.Z, 19941024 Topological Considerations in Isosurface Generation UCSC-CRL-94-31 Allen Van Gelder and Jane Wilhelms Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz June 11, 1994
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-38.ps.Z, 19941024 University of California Santa Cruz Analysis and Transformation of Logic Programs A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Kjell Erik Post December 1994 The dissertation of Kjell Erik Post is
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-41.ps.Z, 19941024 Selective Victim Caching: A Method to Improve the Performance of Direct-Mapped Caches Dimitrios Stiliadis Anujan Varma UCSC-CRL-93-41 October 6, 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Research supported by NSF Young Investigator Award
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/herzberg.ps, 19941101 On Travelling Incognito A. Herzberg H. Krawczyk G. Tsudik IBM T.J. Watson Research Center IBM Z urich Research Laboratory N.Y. 10598, USA CH-8803 R uschlikon, Switzerland famir,hugog@watson.ibm.com gts@zurich.ibm.com
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-42.ps.Z, 19941102 On the Worst-case Analysis of Temporal-difference Learning Algorithms Robert E. Schapirey Manfred K. Warmuthz UCSC-CRL-94-42 October 27, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-42.ps.Z, 19941102 On the Worst-case Analysis of Temporal-difference Learning Algorithms Robert E. Schapirey Manfred K. Warmuthz UCSC-CRL-94-42 October 27, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/nemesis/old/manual.ps, 19941104 The Nemesis User's Manual Craig Hall Brian Chess Tracy Larrabee Computer Engineering University of California, Santa Cruz 95064 1 Introduction Welcome to Nemesis. Nemesis is a diverse program that simulates and generates test patterns for circuits with a variety of different types of faults. Nemesis
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/asokan.ps, 19941109 Anonymity in a Mobile Computing Environment N. Asokan Department of Computer Science University of Waterloo Waterloo, Ont. N2L 3G1, Canada nasokan@uwaterloo.ca
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/samfat.ps, 19941109 A Method Providing Identity Privacy to Mobile Users during Authentication Didier Samfat, Refik Molva Institut Eur ecom 2229 Route des Cr^etes BP 193 - Sophia Antipolis - FRANCE fsamfat, molvag@eurecom.fr
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/alonso.ps, 19941111 A Pen-based Database Interface for Mobile Computers Rafael Alonso V.S. Mani Matsushita Information Technology Laboratory 2 Research Way, 3rd Floor Princeton, NJ 08540 falonso,manig@mitl.research.panasonic.com
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-32.ps.Z, 19941115 1 1 Exploiting the Physics of State-Space Search Robert Levinson UCSC-CRL-94-32 supercedes UCSC-CRL-93-38 September 13, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-41.ps.Z, 19941115 undetected by the stuck-at test sets. In the worst case, where none of the channel-to-row or the cell-to-cell WCA is covered, 20% of the total WCA in the circuit is undetected by the stuck-at tests. On average, most of the shorts from the wiring channel to the cell rows will be detected by the stuckat
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/bartlett.ps, 19941115 W4 - the Wireless World Wide Web Joel F. Bartlett Digital Equipment Corporation Western Research Lab 250 University Avenue Palo Alto, CA 94301 E-mail: bartlett@pa.dec.com
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/alagar.ps, 19941115 Causally Ordered Message Delivery in Mobile Systems Sridhar Alagar and S. Venkatesan Department of Computer Science University of Texas at Dallas, Richardson, TX 75083 fsridhar,venkyg@utdallas.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-41.ps.Z, 19941115 undetected by the stuck-at test sets. In the worst case, where none of the channel-to-row or the cell-to-cell WCA is covered, 20% of the total WCA in the circuit is undetected by the stuck-at tests. On average, most of the shorts from the wiring channel to the cell rows will be detected by the stuckat
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/ebling.ps, 19941117 Overcoming the Network Bottleneck in Mobile Computing Maria R. Ebling, Lily B. Mummert, David C. Steere School of Computer Science Carnegie Mellon University 1 Introduction System designers have traditionally treated the network as an inexhaustible resource, focusing their efforts on optimizingCPU and
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/bennett.ps, 19941117 Teleporting - Making Applications Mobile Frazer Bennett, Tristan Richardson, Andy Harter Olivetti Research Laboratory Old Addenbrooke's Site 24a Trumpington Street Cambridge CB2 1QA United Kingdom
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/voelker.ps, 19941117 Mobisaic: An Information System for a Mobile Wireless Computing Environment Geoffrey M. Voelker and Brian N. Bershad Department of Computer Science and Engineering University of Washington Seattle, WA 98195
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/schilit.ps, 19941117 Context-Aware Computing Applications Bill Schilit Norman Adams Roy Want Computer Science Dept Palo Alto Research Center Palo Alto Research Center Columbia University Xerox Corporation Xerox Corporation New York, NY 10025 Palo Alto, CA 94304 Palo Alto, CA 94304
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/ohara.ps, 19941117 An Architecture to Simplify Communicating Applications Robert O Hara, Senior Software Engineer, Microsoft Corporation One Microsoft Way, Redmond WA 98052 206-936-2159, rohara@microsoft.com
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/saldanha.ps, 19941118 A Hybrid Model for Mobile File Systems John Saldanha and David L. Cohn Distributed Computing Research Laboratory University of Notre Dame, Notre Dame, IN 46556 {jes,dlc}@cse.nd.edu
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/davies.ps, 19941120 Supporting Adaptive Services in a Heterogeneous Mobile Environment Nigel Davies, Gordon S. Blair, Keith Cheverst and Adrian Friday Distributed Multimedia Research Group, Department of Computing, Lancaster University, Bailrigg, Lancaster, LA1 4YR, U.K. telephone: +44 (0)524 65201 e-mail: nigel, gordon,
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/watson.ps, 19941121 Application Design for Wireless Computing Terri Watson Department of Computer Science & Engineering University of Washington Seattle, WA 98195
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/gruber.ps, 19941122 To appear in Proceedings of the IEEE Workshop on Mobile Computing Systems and Applications, Santa Cruz, CA, December 1994. Disconnected Operation in the Thor Object-Oriented Database System Robert Gruber Frans Kaashoeky Barbara Liskov Liuba Shrira Laboratory for Computer Science Massachusetts Institute
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/huston.ps, 19941123 Peephole Log Optimization L.B. Huston lhuston@citi.umich.edu P. Honeyman honey@citi.umich.edu Center for Information Technology Integration University of Michigan Ann Arbor
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/messerschmitt.ps, 19941123 Asynchronous Video Coding for Wireless Transport * David G. Messerschmitt Fellow IEEE EECS Department Univ. of California, Berkeley messer@eecs.berkeley.edu Johnathan M. Reason Student Member IEEE EECS Department Univ. of California, Berkeley reason@eecs.berkeley.edu Allen Y. Lao Student Member IEEE
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/cho.ps, 19941125 A Group Communication Approach for Mobile Computing Kenjiro Choy Kenneth P. Birmanz Media Technology Laboratory Department of Computer Science Canon, Inc. Cornell University Kawasaki, Japan 211 Ithaca, NY 14853-7501
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/mukherjee.ps, 19941127 Mobility: A Medium for Computation, Communication, and Control Arup Mukherjee Daniel P. Siewiorek School of Computer Science Carnegie Mellon University 5000 Forbes Avenue Pittsburgh, PA 15213
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/johnson.ps, 19941127 Routing in Ad Hoc Networks of Mobile Hosts David B. Johnson Computer Science Department Carnegie Mellon University Pittsburgh, PA 15213-3891 dbj@cs.cmu.edu
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/yavatkar.ps, 19941127 References D.C. Cox. Universal Portable Radio Communications. IEEE Communications Magazine, pages 96 115, December 1992. D. Raychaoudhari and N.D.Wilson. ATM-based Transport Architecture for Multiservices Wireless Personal Communication Networks. IEEE Journal on Selected Areas in Communications,
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/asthana.ps, 19941128 An Indoor Wireless System for Personalized Shopping Assistance Abhaya Asthana, Mark Cravatts and Paul Krzyzanowski AT&T Bell Laboratories Murray Hill, New Jersey, 07922, USA
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/bhagwat.ps, 19941128 Transparent Resource Discovery for Mobile Computers Pravin Bhagwat Computer Science Department University of Maryland College Park, MD 20742 Charles E. Perkins T.J. Watson Research Center IBM Hawthorne, NY 10562 Satish K. Tripathi Computer Science Department University of Maryland College Park, MD 20742
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/pitoura.ps, 19941128 Revising Transaction Concepts for Mobile Computing Position Paper Evaggelia Pitoura Bharat Bhargava Department of Computer Sciences Department of Computer Sciences Purdue University Purdue University West Lafayette, IN 47905 West Lafayette, IN 47905 email: pitoura@cs.purdue.edu email: bb@cs.purdue.edu
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/baker.ps, 19941128
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/mazer.ps, 19941128 A Client-Side-Only Approach to Disconnected File Access Murray S. Mazer OSF Research Institute* Joseph J. Tardo Digital Equipment Corporation**
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/kaashoek.ps, 19941128 Dynamic Documents: Mobile Wireless Access to the WWW M. Frans Kaashoek, Tom Pinckney, and Joshua A. Tauber MIT Laboratory for Computer Science 545 Technology Square Cambridge, MA 02139, USA fkaashoek, pinckney, joshg@lcs.mit.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-44.ps.Z, 19941129 Spectral-Based Multi-Way FPGA Partitioning Pak K. Chan , Martine D.F. Schlag,yand Jason Y. Zien Computer Engineering University of California, Santa Cruz Santa Cruz, California 95064 USA November 21, 1994
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/kuenning.ps, 19941129 The Design of the Seer Predictive Caching System Geoffrey H. Kuenning Computer Science Department University of California, Los Angeles Los Angeles, CA 90024 g.kuenning@ieee.org
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/ahamad.ps, 19941130 Detecting Mutual Consistency of Shared Objects Mustaque Ahamad Shawn Smith Francisco Jose Torres-Rojas Rammohan Kordale Department of Computer Science Jasjit Singh Rice University Houston, TX 77005, USA College of Computing Georgia Institute of Technology Atlanta, GA 30332
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/comer.ps, 19941201 Using ATM for a Campus-Scale Wireless Internet Douglas Comer and Vincent Russo Computer Science Department Purdue University West Lafayette, IN 47907
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/zdonik.ps, 19941201 Are Disks in the Air" Just Pie in the Sky Stanley Zdonik Dept. of Computer Science Brown University Providence, RI 02912 Michael Franklin Dept. of Computer Science University of Maryland College Park, MD 20742 Rafael Alonso Matsushita Information Technology Labs. Princeton, NJ 08540 Swarup Acharya
	ftp://ftp.cse.ucsc.edu//pub/wmc-94/fitler.ps, 19941207
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-36.ps.Z, 19941213 Tight worst-case loss bounds for predicting with expert advice David Haussler Jyrki Kivineny Manfred K. Warmuthz UCSC-CRL-94-36 November 3, 1994 (Revised December 8, 1994) Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-36.ps.Z, 19941213 Tight worst-case loss bounds for predicting with expert advice David Haussler Jyrki Kivineny Manfred K. Warmuthz UCSC-CRL-94-36 November 3, 1994 (Revised December 8, 1994) Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/ml/ucsc-crl-94-36.ps.Z, 19941213 Tight worst-case loss bounds for predicting with expert advice David Haussler Jyrki Kivineny Manfred K. Warmuthz UCSC-CRL-94-36 November 3, 1994 (Revised December 8, 1994) Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-47.ps.Z, 19950118 Wavelets: An Elementary Introduction and Examples Masami Ueda Suresh Lodha UCSC-CRL 94-47 January 17, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-46.ps.Z, 19950120 University of California Santa Cruz Estimation of Distributed Parameters by Multiresolution Optimization A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Koji Amakawa December 1994 The dissertation of Koji
	ftp://ftp.cse.ucsc.edu//pub/kolaitis/icdt95bbl.ps.Z, 19950123 Languages for Polynomial-Time Queries an Ongoing Quest Phokion G. Kolaitis Computer and Information Sciences University of California, Santa Cruz Santa Cruz, Ca 95064 U.S.A. kolaitis@cse.ucsc.edu References S. Abiteboul and V. Vianu. Fixpoint extensions of first-order logic and Datalog-like
	ftp://ftp.cse.ucsc.edu//pub/kolaitis/icdt95tu.ps.Z, 19950123 A Tutoriala on Languages for Polynomial-Time Queries: an Ongoing Quest Phokion G. Kolaitis Computer and Information Sciences University of California, Santa Cruz aPresented at ICDT '95 on January 10, 1995. Copyright c 1995 by Phokion G. Kolaitis Two Categories of Research Problems Category I. An area of
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-29.ps.Z, 19950124 Scalable Visualization of Parallel Systems Jorge Garc a Richard Hughey UCSC-CRL-94-29 31 August 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-29.ps.Z, 19950124 Scalable Visualization of Parallel Systems Jorge Garc a Richard Hughey UCSC-CRL-94-29 31 August 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-30.ps.Z, 19950125 An Empirical Study of the Branch Coverage of Different Fault Classes Melissa S. Cline Linda. L. Werner UCSC-CRL-94-30 September 5, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-30.ps.Z, 19950125 An Empirical Study of the Branch Coverage of Different Fault Classes Melissa S. Cline Linda. L. Werner UCSC-CRL-94-30 September 5, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/resume7.ps.Z, 19950128 n CRAIG M. WITTENBRINK n Computer Engineering University Of California 225 Applied Sciences Bldg. Santa Cruz, California 95064 408 459-4099 craig@cse.ucsc.edu Home: 755 14th Avenue, Apt. 812 Santa Cruz, California 95062 408 479-9253 http://www.cse.ucsc.edu/~craig/ Degrees: n B.S. 1987, University of
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/spie95.bump.ps.gz, 19950202 Bump Mapped Vector Fields Alex Pang and Naim Alper Baskin Center for Computer Engineering & Information Sciences University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-45.ps.Z, 19950203 University of California Santa Cruz Exact Arithmetic in Q with Applications in Celestial Mechanics A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Al Conrad December 1994 The dissertation of Al Conrad is
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/SPIEGlyph.ps.Z, 19950204 Glyphs for Visualizing Uncertainty in Environmental Vector Fields Craig M. Wittenbrink, Elijah Saxon, Jeff J. Furman, Alex Pang, and Suresh Lodha Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/spray/userguide.ps.Z, 19950210 SPRAY ANALYSIS MODE USER GUIDE Naim Alper January, 1995 Contents 1 Introduction 1 2 Spray Parts 1 2.1 Browsers : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : 3 2.2 Can View Window : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : :
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-14.ps.Z, 19950215 Duality between L-bases and B-bases Suresh Lodha Ron Goldman UCSC-CRL 95-14 February 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-13.ps.Z, 19950217 Performance of TCP over Multi-Hop ATM Networks: A Comparative Study of ATM-Layer Congestion Control Schemes Lampros Kalampoukas Anujan Varma UCSC-CRL-95-13 February 16, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-07.ps.Z, 19950217 SAM Sequence Alignment and Modeling Software System Richard Hughey rph@cse.ucsc.edu Anders Krogh krogh@nordita.dk Baskin Center for Computer Engineering and Information Sciences University of California Santa Cruz, CA 95064 Technical Report UCSC-CRL-95-7 January 1995 Version 1.0
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-01.ps.Z, 19950217 Modeling Animals with Bones, Muscles, and Skin Jane Wilhelms USCS-CRL-95-01 January 24, 1994 Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/2_8_conf_talk.ps.Z, 19950227 UNIVERSITY OF CALIFORNIA, SANTA CRUZ copyright Wittenbrink 1995 Glyphs for Visualizing Uncertainty in Environmental Vector Fields Craig M. Wittenbrink, E. Saxon, J.J. Furman, A. Pang, and S. Lodha Collaborators: Naim Alper, Dan Fernandez, Harwood Kolsky,Wendel Nuss UCSC copyright Wittenbrink 1995 n Data
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ipps94talk.ps.Z, 19950227 copyright 1995 Craig M. Wittenbrink Conclusions n Permutation Warping optimal O(1) Communication O(n3/P) Runtime O(n3/P) storage n Accurate n View angle freedom n User Interface n Proteus Research Prototype Results 23x Speedup on 32 Processors 2 frames/second 1283 volume copyright 1995 Craig M.
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/onr9_13_94.ps.Z, 19950227 copyright 1995 Craig M. Wittenbrink Visualizing Uncertainty Craig M. Wittenbrink Board of Computer Engineering University of California Santa Cruz, CA 95064 copyright 1995 Craig M. Wittenbrink Overview n Data Validity n Data Pipeline n The Challenge: Uncertainty Visualization n Example: NOAA Wind
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-15.ps.Z, 19950315 Pin Assignment and Routing on a Single-Layer Pin Grid Array Man-fai Yu Wayne Wei-Ming Dai UCSC-CRL-95-15 February 24, 1995 For Submission to ASPDAC'95 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Phone: +1 (408)459-4954 or +1 (408)459-4234 Fax: +1
	ftp://ftp.cse.ucsc.edu//pub/borg/oguide.ps.Z, 19950322 A Field-Programmable Prototyping Board: XC4000 BORG User's Guide Pak K. Chan UCSC-CRL-94-18 April 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-17.ps.Z, 19950322 A New Data Structure for Cumulative Probability Tables : an Improved Frequency-to-Symbol Algorithm. Peter M. Fenwick UCSC-CRL-95-17 March 20, 1995 Department of Computer Science, The University of Auckland, Private Bag 92019, Auckland, New Zealand. peter-f@cs.auckland.ac.nz
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-16.ps.Z, 19950324 also be caused by off-site communications failures, ranging from temporary routing failures to problems with the physical communications links. We have not attempted to characterize the causes of failure, though it seems that most failures are brief and are probably caused by software faults or
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-39.ps.Z, 19950329 An Iterative Approach for Delay-Bounded Minimum Steiner Tree Construction Qing Zhu Mehrdad Parsa Wayne W.M. Dai Board of Studies in Computer Engineering University of California, Santa Cruz, CA 95064 qingz, courant, dai@cse.ucsc.edu UCSC-CRL-94-39, Oct. 1994
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-39.ps.Z, 19950329 An Iterative Approach for Delay-Bounded Minimum Steiner Tree Construction Qing Zhu Mehrdad Parsa Wayne W.M. Dai Board of Studies in Computer Engineering University of California, Santa Cruz, CA 95064 qingz, courant, dai@cse.ucsc.edu UCSC-CRL-94-39, Oct. 1994
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-11.ps.Z, 19950404 Regularizers for Estimating Distributions of Amino Acids from Small Samples Kevin Karplus ucsc-crl-95-11 30 March 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-48.ps.Z, 19950404 Parallelizing Subgraph Isomorphism Refinement for Classification and Retrieval of Conceptual Structures James D. Roberts UCSC-CRL-94-48 December 20, 1994 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-49.ps.Z, 19950406 University of California Santa Cruz Performance Evaluation of Systems with Restricted Overlap of Resources A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer Engineering by David E. Levy September 1994 The dissertation of David E. Levy
	ftp://ftp.cse.ucsc.edu//pub/sculpt/SAMIAM.usersguide.ps, 19950414 1 1. User's Guide to the SAM-IAM Sculpting System In this document we describe all operations available to users of the SAM-IAM polygon mesh based sculpting system developed by Jim Bill as part of his Master's Thesis. Currently the most up to date code and executable reside in the directory
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/lab2.ps.Z, 19950417 CE 261: Lab #2 Introduction to the Image Vision Libraries April 16, 1995 2 cd mkdir ImageVision Make a copy of the file in ~/ilguide/*. cd ImageVision cp -r ~/ilguide . At the same directory level as the ilguide make the following soft link: ln -s /usr/share/people/4Dgifts/examples/ImageVision/images
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/hom2.ps.Z, 19950417 CE 261: Homework #2 Point Processing and Histogram EqualizationApril 12, 1995 1 CE 261: Homework #2 Point Processing and Histogram Equalization Spring 1995 Instructor: Dr. Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Wednesday, April 19, 1995.
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/syllabus.ps.Z, 19950417 CE 261: Digital Image Processing April 4, 1995 2 Reading list: Gonzales and Woods, Papers and notes to be made available. Reference material: Encyclopedia of Graphics File Formats by Murray and vanRyper, 1994 Multidimensional Digital Signal Processing, by Dudgeon and Mersereau, 1984. Computer Graphics,
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/lab1.ps.Z, 19950417 CE 261: Lab #1 Image Processing Familiarization April 4, 1995 3 image with the lasso, or the selection box. Then select Image->Map->Equalize, (selected area), and experiment with histogram equalization with parts of the body. Keep only a portion of the image selected (say the eyes) and do a
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/hom1.ps.Z, 19950417 CE 261: Homework #1 Digital Image Fundamentals April 4, 1995 1 CE 261: Homework #1 Digital Image Fundamentals Spring 1995 Instructor: Dr. Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Wednesday, April 12, 1995. Assignments are due at the beginning
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/hom3.ps.Z, 19950419 CE 261: Homework #3 Windowed Processing and Mathematical MorphologyApril 19, 1995 1 CE 261: Homework #3 Windowed Processing and Mathematical Morphology Spring 1995 Instructor: Dr. Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Wednesday, April 26,
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-05.ps.Z, 19950502 Transient Analysis of Interconnect Networks Characterized by Measured Scattering-Parameter Data Jimmy Shinn-Hwa Wang Wayne Wei-Ming Dai UCSC-CRL-95-05 April 10, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-03.ps.Z, 19950502 Transformation of Min-Max Optimization to Least-Square Estimation and Application to Interconnect Design Optimization Jimmy Shinn-Hwa Wang Wayne Wei-Ming Dai UCSC-CRL-95-03 March 6, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-04.ps.Z, 19950502 Transient Analysis of Coupled Transmission Lines Characterized with the Frequency-Dependent Losses Using Scattering-Parameter Based Macromodel Jimmy Shinn-Hwa Wang Wayne Wei-Ming Dai UCSC-CRL-95-04 March 6, 1995 Baskin Center for Computer Engineering & Information Sciences University of California,
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-18.ps.Z, 19950502 Single-Layer Fanout Routing and Routability Analysis for Ball Grid Arrays Man-fai Yu Wayne Wei-Ming Dai UCSC-CRL-95-18 April 25, 1995 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Phone: +1 (408)459-4954 or +1 (408)459-4234 Fax: +1 (408)459-4829
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-22.ps.Z, 19950502 An Implementation Model for Contexts and Negation in Conceptual Graphs John Esch & Robert Levinson UCSC-CRL-95-22 May 1, 1995 Unisys Government Systems Group P.O. Box 64525 U1T23 St. Paul, MN 55164 (612) 456-3947 esch@email.sp.paramax.com Department of Computer and Information Sciences 225 Applied
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-21.ps.Z, 19950502 Extraction of Breaks in Rectilinear Layouts by Plane Sweeps Jeffrey S. Rogenski UCSC-CRL-94-21 April 21, 1995 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-21.ps.Z, 19950502 Extraction of Breaks in Rectilinear Layouts by Plane Sweeps Jeffrey S. Rogenski UCSC-CRL-94-21 April 21, 1995 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/rna/ismb95.rna.ps.Z, 19950505 Automatic RNA Secondary Structure Determination with Stochastic Context-Free Grammars Leslie Grate Department of Computer Engineering University of California, Santa Cruz, CA 95064, USA Email: leslie@cse.ucsc.edu Keywords: RNA secondary structure, multiple alignment, stochastic context-free grammars,
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/resume8.ps.Z, 19950508 n CRAIG M. WITTENBRINK n Computer Engineering University Of California 225 Applied Sciences Bldg. Santa Cruz, California 95064 408 459-4099 craig@cse.ucsc.edu Home: 755 14th Avenue, Apt. 812 Santa Cruz, California 95062 408 479-9253 http://www.cse.ucsc.edu/~craig/ Degrees: n B.S. 1987, University of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-06.ps.Z, 19950509 General Game-Playing and Reinforcement Learning Robert Levinson UCSC-CRL-95-06 supersedes UCSC-CRL-93-38 and UCSC-CRL-94-32 partially supported by NSF Grant IRI-9112862 May 5, 1995 Department of Computer Science, University of California, Santa Cruz, CA 95060 E-mail:levinson@cse.ucsc.edu Phone:
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/hom5.ps.Z, 19950510 CE 261: Homework #5 Compression May 9, 1995 1 CE 261: Homework #5 Compression Spring 1995 Instructor: Dr. Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Wednesday, May 17, 1995. Assignments are due at the beginning of class. Please put your full
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/hom4.ps.Z, 19950510 CE 261: Homework #4 Image Processing Applications and Data StructuresMay 5, 1995 1 CE 261: Homework #4 Image Processing Applications and Data Structures Spring 1995 Instructor: Dr. Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Wednesday, May 10,
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/lab3.ps.Z, 19950512 CE 261: Lab #3 ImageVision Libraries Satellite Application DevelopmentMay 12, 1995 1 CE 261: Lab #3 ImageVision Libraries Satellite Application Development Spring 1995 Instructor: Dr. Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Friday May 26.
	ftp://ftp.cse.ucsc.edu//pub/refdbms/other/HPL-CCD-95-9.ps.Z, 19950516 1 Introduction What are we trying to solve Analyzing fault-tolerance protocols for distributed systems o replication protocols o weak-consistency group communication Analysis depends on accurate model of systems Failure in a distributed systems sense: inability to contact a host 2 Introduction Measures
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/hom6.ps.Z, 19950518 CE 261: Homework #6 Image Segmentation May 18, 1995 1 CE 261: Homework #6 Image Segmentation Spring 1995 Instructor: Dr. Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Wednesday, May 24, 1995. Assignments are due at the beginning of class. Please
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/compcon95.ps.Z, 19950522 REINAS: the Real-Time Environmental Information Network and Analysis System Darrell D. E. Long, Patrick E. Mantey, Craig M. Wittenbrink, Theodore R. Haining, Bruce R. Montaguey University of California, Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/T_5_J.ps.Z, 19950522 Cache Tiling for High Performance Morphological Image Processing Craig M. Wittenbrink Arun K. Somani Dept. of Electrical Engineering, (and Dept. of Computer Science and Engineering) University of Washington MS FT-10, Seattle, WA USA 98195 Appears as: Cache tiling for high performance morphological image
	ftp://ftp.cse.ucsc.edu//pub/kolaitis/pods95tu.ps.Z, 19950526 A Tutorial a on Combinatorial Games in Database Theory Phokion G. Kolaitis Computer and Information Sciences University of California, Santa Cruz aPresented at PODS '95 on May 24, 1995 c Phokion G. Kolaitis Database Query Languages The study of database query languages has occupied a prominent place in
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/lab4.ps.Z, 19950526 CE 261: Lab #4 ImageVision Libraries Satellite Application Development, Part IIMay 25, 1995 1 CE 261: Lab #4 ImageVision Libraries Satellite Application Development, Part II Spring 1995 Instructor: Dr. Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due:
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce261/hom7.ps.Z, 19950526 CE 261: Homework #7 Recognition and Interpretation May 25, 1995 1 CE 261: Homework #7 Recognition and Interpretation Spring 1995 Instructor: Dr. Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Wednesday, June 7, 1995. Assignments are due at the
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/jochen.sigcomm94.ps.gz, 19950606 Distributed, Scalable Routing Based on Link-State Vectors Jochen Behrens J.J. Garcia-Luna-Aceves University of California Santa Cruz, California 95064 jochen, jj@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/shree.ic3n.ps.gz, 19950606 A LOOP-FREE ALGORITHM BASED ON PREDECESSOR INFORMATION Shree Murthy and J.J. Garcia-Luna-Aceves University of California Santa Cruz, CA 95064 shree, jj@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/jochen.jsac.ps.gz, 19950606 1 Distributed, Scalable Routing Based on Vectors of Link States J.J. Garcia-Luna-Aceves, Member, IEEE, and Jochen Behrens, Student Member, IEEE
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/chane.sigcomm.ps.gz, 19950606 Floor Acquisition Multiple Access (FAMA) for Packet-Radio Networks Chane L. Fullmer and J.J. Garcia-Luna-Aceves Computer Engineering University of California Santa Cruz, CA 95064 chane,jj@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/shree.asilomar.ps.gz, 19950606 A More Efficient Path-Finding Algorithm Shree Murthy and J.J. Garcia-Luna-Aceves Baskin Center for Computer Engineering and Information Sciences University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-43.ps.Z, 19950607 1 REINAS: Real-Time Environmental Information Network and Analysis System: Phase IV.1-EXPERIMENTATION P.E. Mantey, D.D.E. Long,J.J. Garcia-Luna, A.T. Pang, H.G. Kolsky (UCSC), B.R. Gritton (MBARI), W.A. Nuss (NPS) UCSC-CRL-94-43 October 25, 1994 Baskin Center for Computer Engineering and Information
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-43.ps.Z, 19950607 1 REINAS: Real-Time Environmental Information Network and Analysis System: Phase IV.1-EXPERIMENTATION P.E. Mantey, D.D.E. Long,J.J. Garcia-Luna, A.T. Pang, H.G. Kolsky (UCSC), B.R. Gritton (MBARI), W.A. Nuss (NPS) UCSC-CRL-94-43 October 25, 1994 Baskin Center for Computer Engineering and Information
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-93-05.ps.Z, 19950607 1 REINAS: Real-Time Environmental Information Network and Analysis System: Concept Statement* Darrell D.E. Long, Patrick E. Mantey Alex T. Pang, Glen G. Langdon, Jr., Robert A. Levinson, Harwood G. Kolsky, Bruce R. Gritton (MBARI), Carlyle H. Wash (NPS), Leslie K. Rosenfeld (NPS/MBARI) UCSC-CRL-93-05
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-93-05.ps.Z, 19950607 1 REINAS: Real-Time Environmental Information Network and Analysis System: Concept Statement* Darrell D.E. Long, Patrick E. Mantey Alex T. Pang, Glen G. Langdon, Jr., Robert A. Levinson, Harwood G. Kolsky, Bruce R. Gritton (MBARI), Carlyle H. Wash (NPS), Leslie K. Rosenfeld (NPS/MBARI) UCSC-CRL-93-05
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/cspray_paper.ps.Z, 19950608 CSpray: A Collaborative Scientific Visualization Application Alex Pang, Craig M. Wittenbrink and Tom Goodman Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/peter.apcc95.ps.gz, 19950608 FLOOR CONTROL FOR ACTIVITY COORDINATION IN NETWORKED MULTIMEDIA APPLICATIONS H.-Peter Dommel ffl J.J. Garcia-Luna-Aceves peter@cse.ucsc.edu ffl jj@cse.ucsc.edu Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/peter.spie95.ps.gz, 19950608 Design issues for floor control protocols Hans-Peter Dommel and J.J. Garcia-Luna-Aceves Baskin Center for Computer Engineering & Information Sciences University of California Santa Cruz, CA 95064 peter@cse.ucsc.edu ffl jj@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/spie95_glyph.ps.Z, 19950608 Glyphs for Visualizing Uncertainty in Environmental Vector Fields Craig M. Wittenbrink, Elijah Saxon, Jeff J. Furman, Alex Pang, and Suresh Lodha Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-28.ps.Z, 19950612 University of California Santa Cruz Chip and Package Co-Design of Clock Networks A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer Engineering by Qing Zhu June 1995 The dissertation of Qing Zhu is approved: Wayne Wei-Ming Dai David
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-25.ps.Z, 19950615 University of California Santa Cruz Transient Analysis of Coupled Transmission Lines Characterized with Frequency-Dependent Losses or Measured Scattering-Parameter Data and Optimal Design of Self-Damped Interconnects A dissertation submitted in partial satisfaction of the requirements for the degree of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-19.ps.Z, 19950615 How to Use Expert Advice Nicol o Cesa-Bianchi Yoav Freundy David P. Helmboldz David Hausslerx Robert E. Schapire{ Manfred K. Warmuthk UCSC-CRL-95-19 June 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/ml/ucsc-crl-95-19.ps.Z, 19950615 How to Use Expert Advice Nicol o Cesa-Bianchi Yoav Freundy David P. Helmboldz David Hausslerx Robert E. Schapire{ Manfred K. Warmuthk UCSC-CRL-95-19 June 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/borg/guide.ps.Z, 19950628 A Field-Programmable Prototyping Board: XC4000 BORG User's Guide Pak K. Chan UCSC-CRL-94-18 April 1994 (6/27/95 revised) Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-31.ps.Z, 19950717 Hierarchically Accelerated Ray Casting for Volume Rendering with Controlled Error Allen Van Gelder Kwansik Kim Jane Wilhelms Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 UCSC-CRL-95-31 avg@cs.ucsc.edu ksk@cs.ucsc.edu wilhelms@cs.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/eurographics.ginzu.ps.gz, 19950718 Metaphors for visualization Alex Pang and Michael Clifton Computer and Information Sciences Board University of California, Santa Cruz California, 95064, USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/spie95.cspray.ps.gz, 19950719 CSpray: A Collaborative Scientific Visualization Application Alex Pang, Craig M. Wittenbrink and Tom Goodman Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/sig.mve.ps.gz, 19950719 Spray Rendering as a Modular Visualization Environment Alex Pang and Craig Wittenbrink Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 Spray rendering is a modular visualization environment (MVE) similar in many ways to AVS, IBM DX,
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/cga.spray.ps.gz, 19950719 Spray Rendering Alex Pang Computer and Information Sciences Board University of California, Santa Cruz Spray rendering is a framework for creating and experimenting with different visualization techniques. The name spray rendering is derived from the metaphor of using a virtual spray can to paint data
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-30.ps.Z, 19950725 Detection of multiple faults in two-dimensional ILAs Martine Schlag and F. Joel Ferguson UCSC-CRL-95-30 June 13, 1995 Associate Professors of Computer Engineering Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/vol2col.ps.Z, 19950726 A Scalable MIMD Volume Rendering Algorithm Craig M. Wittenbrink Michael Harrington Dept. of Electrical Engineering, Applied Physics Laboratory University of Washington University of Washington Seattle, WA 98195 Seattle, WA 98105 e-mail: craig@shasta.ee.washington.edu mikeh@apl.washington.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-20.ps.Z, 19950727 University of California Santa Cruz Mix&Match : A Construction Kit for Scientific Visualization A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer Engineering by Naim Alper March 1995 The dissertation of Naim Alper is approved: Dr.
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-24.ps.Z, 19950727 UNIVERSITY OF CALIFORNIA SANTA CRUZ Scattering-Parameter-Based Macromodel for Transient Analysis of Interconnect Networks with Nonlinear Terminations A dissertation submitted in partial satisfaction of the requirements for the degree of DOCTOR OF PHILOSOPHY in COMPUTER ENGINEERING by Haifang Liao May
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-26.ps.Z, 19950727 University of California Santa Cruz Objective-Based Routing For Physical Design-For-Test A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer Engineering by Richard McGowen June 1995 The dissertation of Richard McGowen is approved: F.
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-37.ps.Z, 19950731 Efficient Learning with Virtual Threshold Gates Wolfgang Maass Manfred K. Warmuthy UCSC-CRL-95-37 July 28, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-32.ps.Z, 19950802 Linear Time Unit Resolution for Propositional Formulas\|in Prolog, yet Allen Van Gelder Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 UCSC-CRL-95-32 avg@cs.ucsc.edu April 19, 1995
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-27.ps.Z, 19950804 University of California Santa Cruz Hierarchical Rendering of Complex Environments A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer and Information Sciences by Ned Greene June 1995 Copyright c 1995 by Ned Greene iii Contents
	ftp://ftp.cse.ucsc.edu//pub/ml/trac_expert.ml95.ps, 19950817 Tracking the Best Expert Mark Herbster and Manfred Warmuth Computer and Information Sciences University of California, Santa Cruz mark@cs.ucsc.edu, manfred@cs.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/ml/disj_proc.ps.Z, 19950817 Tracking the best disjunction Peter Auer Manfred K. Warmuthy Department of Computer Science University of California at Santa Cruz Santa Cruz, CA 95064 (USA)
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-09.ps.Z, 19950818 Distributed Degree-Constrained Multicasting in Point-to-Point Networks Fred Bauer Anujan Varma UCSC-CRL-95-09 March 3, 1995 Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-08.ps.Z, 19950818 Degree-Constrained Multicasting in Point-to-Point Networks Fred Bauer Anujan Varma UCSC-CRL-95-08 February 17, 1995 Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/ml/coltpaper.ps.Z, 19950821 General Bounds on the Mutual Information Between a Parameter and n Conditionally Independent Observations David Haussler UC Santa Cruz Manfred Oppery Universit at W urzburg
	ftp://ftp.cse.ucsc.edu//pub/ml/rigcurve.ps.Z, 19950821 Rigorous Learning Curve Bounds from Statistical Mechanics David Haussler U.C. Santa Cruz Santa Cruz, California Michael Kearns AT&T Bell Laboratories Murray Hill, New Jersey H. Sebastian Seung AT&T Bell Laboratories Murray Hill, New Jersey Naftali Tishby Hebrew University Jerusalem, Israel
	ftp://ftp.cse.ucsc.edu//pub/ml/prl.ps.Z, 19950822 Bounds for Predictive Errors in the Statistical Mechanics of Supervised Learning Manfred Opper Institiut f ur Theoretische Physik III, Universit at W urzburg, Germany David Haussler Department of Computer and Information Sciences, UC Santa Cruz, U.S.A.
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/chane.mcn95.ps.gz, 19950825 FAMA-PJ: A Channel Access Protocol for Wireless LANs Chane L. Fullmer and J.J. Garcia-Luna-Aceves Computer Engineering University of California, Santa Cruz, California 95064 chane, jj @cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/ml/kw-pawllmbwfivr-95.ps.Z, 19950825 The Perceptron algorithm vs. Winnow: linear vs. logarithmic mistake bounds when few input variables are relevant Jyrki Kivinen Department of Computer Science P.O. Box 26 (Teollisuuskatu 23) FIN-00014 University of Helsinki, Finland jkivinen@cs.helsinki.fi Manfred K. Warmuthy Computer and Information
	ftp://ftp.cse.ucsc.edu//pub/protein/dirichlet/ismb93.ps.Z, 19950827 Using Dirichlet Mixture Priors to Derive Hidden Markov Models for Protein Familiesz Michael Brown Computer Science University of California Santa Cruz, CA 95064 mpbrown@cse.ucsc.edu Richard Hughey Computer Engineering University of California Santa Cruz, CA 95064 rph@cse.ucsc.edu Anders Krogh
	ftp://ftp.cse.ucsc.edu//pub/kolaitis/iclmps95.ps.Z, 19950829 Fixpoint Logic, Implicit Definability, and Infinitary Logic in Finite Model Theory Phokion G. Kolaitis Computer and Information Sciences University of California, Santa Cruz Santa Cruz, California U.S.A Finite Model Theory Study of logics on classes of finite structures Examples of Classes ffl all
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/isca95.ps.Z, 19950905 Destage Algorithms for Disk Arrays with Non-Volatile Caches Anujan Varma and Quinn Jacobson Computer Engineering Department University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/ocean95.rvis.ps.gz, 19950908 REINAS Instrumentation and Visualization Alex Pang and Dan Fernandez Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/MUG95_v.ps.Z, 19950908 FAST: An FPGA-based Simulation Testbed for ATM Networks Anujan Varma and Dimitrios Stiliadis Computer Engineering Department University of California Santa Cruz, CA 95064 September 1, 1995 Outline ffl FAST: Motivation and description. ffl Board design ffl High-level synthesis Integration with FPGA
	ftp://ftp.cse.ucsc.edu//pub/ml/trees.ps.Z, 19950926 Appearing in Proceedings of the Eighth Annual Conference on Computational Learning Theory, July, 1995. Predicting nearly as well as the best pruning of a decision tree David P. Helmbold Computer and Information Sciences University of California Santa Cruz, CA 95064 dph@cse.ucsc.edu Robert E. Schapire
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-44.ps.Z, 19951006 The Perceptron algorithm vs. Winnow: linear vs. logarithmic mistake bounds when few input variables are relevant Jyrki Kivinen Manfred K. Warmuthy UCSC-CRL-95-44 October 6, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-47.ps.Z, 19951010 FAST: An FPGA-Based Simulation Testbed for ATM Networks Dimitrios Stiliadis Anujan Varma UCSC-CRL-95-47 September 8, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/sculpt/thesis.ps.gz, 19951011 University of California Santa Cruz Computer Sculpting of Polygonal Models using Virtual Tools A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer and Information Sciences by James R. Bill June 1994 The thesis of James R. Bill is approved: Dr.
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/matching.ps.Z, 19951027 Providing Bandwidth Guarantees in an Input-Buffered Crossbar Switch Dimitrios Stiliadis Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064 August 4, 1994 This research is supported by the University of California MICRO program, NSF Young Investigator Award No.
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-09.ps.Z, 19951027 Distributed Degree-Constrained Multicasting in Point-to-Point Networks Fred Bauer Anujan Varma UCSC-CRL-95-09 March 3, 1995 Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-13.ps.Z, 19951027 Performance of TCP over Multi-Hop ATM Networks: A Comparative Study of ATM-Layer Congestion Control Schemes Lampros Kalampoukas Anujan Varma UCSC-CRL-95-13 February 16, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/fred-globecom-95.ps.Z, 19951027 Distributed Algorithms for Multicast Path Setup in Data Networks Fred Bauer and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/fred-infocom-95.ps.Z, 19951027 Degree-Constrained Multicasting in Point-to-Point Networks Fred Bauer and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/HPN95.ps.Z, 19951027 An efficient rate allocation algorithm for ATM networks providing max-min fairness L. Kalampoukas, A. Varma Computer Engineering Department University of California, Santa Cruz, CA 95064, USA E-mail: flampros,varmag@cse.ucsc.edu K. K. Ramakrishnan AT&T Bell Laboratories, Murray Hill, NJ 07974, USA
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-93-41.ps.Z, 19951027 Selective Victim Caching: A Method to Improve the Performance of Direct-Mapped Caches Dimitrios Stiliadis Anujan Varma UCSC-CRL-93-41 October 6, 1994 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Research supported by NSF Young Investigator Award
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-39.ps.Z, 19951027 Frame-based Fair Queueing: A New Traffic Scheduling Algorithm for Packet-Switched Networks Dimitrios Stiliadis Anujan Varma UCSC-CRL-95-39 July 18, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ICC95.ps.Z, 19951027 Performance of TCP over Multi-Hop ATM Networks: A Comparative Study of ATM-Layer Congestion Control Schemes Lampros Kalampoukas and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA, 95064
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-08.ps.Z, 19951027 Degree-Constrained Multicasting in Point-to-Point Networks Fred Bauer Anujan Varma UCSC-CRL-95-08 February 17, 1995 Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/cpukit.ps.Z, 19951028 The CPU Design Kit: An Instructional Prototyping Platform for Teaching Processor Design Anujan Varma, Lampros Kalampoukas Dimitrios Stiliadis, and Quinn Jacobson Computer Engineering Department University of California Santa Cruz, CA 95064 e-mail: varma@cse.ucsc.edu October 28, 1995 1. Introduction Many
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/shree.mcn95.ps.gz, 19951102 A Routing Protocol for Packet Radio Networks Shree Murthy and J.J. Garcia-Luna-Aceves Computer Engineering University of California Santa Cruz, CA 95064 shree, jj@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/shree.globecom95.ps.gz, 19951102 1 DYNAMICS OF A LOOP-FREE PATH-FINDING ALGORITHM Shree Murthy and J.J. Garcia-Luna-Aceves Computer Engineering Department, 225, Applied Sciences Building University of California, Santa Cruz, CA 95064 U.S.A
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-34.ps.Z, 19951108 Satisfiability Testing with More Reasoning and Less Guessing Allen Van Gelder Yumi K. Tsuji Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 UCSC-CRL-95-34 avg@cs.ucsc.edu tsuji@cs.ucsc.edu April 21, 1995
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-48.ps.Z, 19951108 Verity Visualization: Visual Mappings Craig M. Wittenbrink Alex T. Pang Suresh Lodha UCSC-CRL-95-48 October 11, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-49.ps.Z, 19951108 Planar Interchangeable 2-Terminal Routing Man-Fai Yu Joel Darnauer Wayne Wei-Ming Dai UCSC-CRL-95-49 October 19, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-50.ps.Z, 19951108 A Comparison of New and Old Algorithms for A Mixture Estimation Problem David P. Helmbold Robert E. Schapirey Yoram Singerz Manfred K. Warmuthx UCSC-CRL-95-50 October 27, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/protein/dirichlet/Blocks9.ps.Z, 19951109 Blocks9 Blocks9.1 Blocks9.2 Blocks9.3 Blocks9.4 Blocks9.5 Blocks9.6 Blocks9.7 Blocks9.8 Blocks9.9 q 0.178091 0.056591 0.0960191 0.0781233 0.0834977 0.0904123 0.114468 0.0682132 0.234585 j~ffj 1.180650 1.355830 6.664360 2.081410 2.081010 2.568190 1.766060 4.987680 0.099500 A 0.270671 0.021465 0.561459
	ftp://ftp.cse.ucsc.edu/pub/amoeba/Intro.ps.Z, 19951114 The Amoeba Distributed Operating System Andrew S. Tanenbaum Vrije Universiteit De Boelelaan 1081a Amsterdam, The Netherlands Email: ast@cs.vu.nl 1. INTRODUCTION Roughly speaking, we can divide the history of modern computing into the following eras: d 1970s: Timesharing (1 computer with many users) d
	ftp://ftp.cse.ucsc.edu//pub/rna/pseudoknot.ps.gz, 19951120 RNA Pseudoknot Modeling Using Intersections of Stochastic Context Free Grammars with Applications to Database Search Michael Brown, Computer and Information Sciences Charles Wilson, Department of Biology University of California Santa Cruz, CA 95064, USA October 3, 1995
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/vis93.smart.ps.gz, 19951129 Spray Rendering: Visualization Using Smart Particles Alex Pang and Kyle Smith Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/PG.Multicast.ps.gz, 19951215 1 Scalable Internet Multicast Routing M. Parsa, and J.J. Garcia-Luna-Aceves Department of Computer Engineering University of California Santa Cruz, CA 95064 courant, jj@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/ZPG.Multicast.Apr.95.ps.gz, 19951215 1 A SOURCE-BASED ALGORITHM FOR DELAY-CONSTRAINED MINIMUM-COST MULTICASTING Qing Zhu, Mehrdad Parsa, and J.J. Garcia-Luna-Aceves Department of Computer Engineering University of California Santa Cruz, CA 95064 qingz, courant, jj@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-51.ps.Z, 19951222 Synchronous/Reactive Programming of Concurrent System Software Bruce R. Montague and Charles E. McDowell Computer and Information Sciences University of California, Santa Cruz UCSC-CRL-95-51 November 28, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-55.ps.Z, 19951222 Fast Parameters Extraction of General Three-Dimension Interconnects Using Geometry Independent Measured Equation of Invariance Weikai Sun Wei Hong Wayne Wei-Ming Dai UCSC-CRL-95-55 December 7, 1995 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Phone:
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-56.ps.Z, 19951222 A Novel Dimension Reduction Technique for 3D Capacitance Extraction of VLSI Interconnects Wei Hong Weikai Sun Wayne Wei-Ming Dai UCSC-CRL-95-56 December 7, 1995 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Phone: +1 (408)459-4954 or +1 (408)459-4234
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-10.ps.Z, 19951222 Distributed Algorithms for Multicast Path Setup in Data Networks Fred Bauer Anujan Varma UCSC-CRL-95-10 August 16, 1995 Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-45.ps.Z, 19951222 On the Invariance of Measured Equation of Invariance Wei Hong Weikai Sun Wayne Wei-Ming Dai UCSC-CRL-95-45 December 7, 1995 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Phone: +1 (408) 459-4954 or +1 (408) 459-4234 Fax: +1 (408) 459-4829 e-mail:
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-36.ps.Z, 19951222 ARIES: A Rearrangeable Inexpensive Edge-based On-line Steiner Algorithm Fred Bauer Anujan Varma UCSC-CRL-95-36 July 18, 1995 Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/spie_96_paper.ps.Z, 19951222 Feature extraction of clouds from GOES satellite data for integrated model measurement visualization Craig M. Wittenbrink, Glen Langdon, Jr. Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 and Gabriel Fern andez Signal Processing
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom1.ps, 19960109 CE 110: Homework #1 Computer Organization and PerformanceJanuary 3, 1996 1 CE 110: Homework #1 Computer Organization and Performance Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Monday,January 8, 1996. Assignments are due
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom2.ps, 19960109 CE 110: Homework #2 Instruction Set Design January 9, 1996 1 CE 110: Homework #2 Instruction Set Design Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Friday, January 12, 1996. Assignments are due at the beginning of class.
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom3.ps, 19960111 CE 110: Homework #3 Computer Arithmetic January 10, 1996 1 CE 110: Homework #3 Computer Arithmetic Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Friday, January 19, 1996. Assignments are due at the beginning of class. Please
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-54.ps.Z, 19960111 Dynamics of an Explicit Rate Allocation Algorithm for Available Bit-Rate (ABR) Service in ATM Networks Lampros Kalampoukas , Anujan Varma and K. K. Ramakrishnany UCSC-CRL-95-54 December 5, 1995 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 yAT&T Bell
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/syllabus_wtr_96.ps, 19960111 CE 110: Computer Architecture January 10, 1996 2 Science Library Reserves: Computer Organization & Design: The Hardware Software Interface. David A. Patterson and John L. Hennessy, Morgan Kaufmann, San Francisco, CA, 1994. High-Performance Computer Architecture, Harold S. Stone, 3rd ed., Addison-Wesley,
	ftp://ftp.cse.ucsc.edu//pub/protein/dirichlet/newphat.ps.Z, 19960111 Computing the estimated amino acids using a Dirichlet mixture prior For a column in a multiple alignment, we create a vector of counts ~n for the amino acids in that column, where ni is the number of times the ith amino acid is observed. Then, given a Dirichlet mixture density , consisting of the
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/shree.winet.ps.gz, 19960112 Baltzer Journals An Efficient Routing Protocol for Wireless Networks Shree Murthy and J.J. Garcia-Luna-Aceves Computer Engineering, University of California, Santa Cruz, CA 95064 We present the wireless routing protocol (WRP). In WRP, routing nodes communicate the distance and second-to-last hop for
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom4.ps, 19960120 CE 110: Homework #4 Digital Logic and Processor Data PathJanuary 19, 1996 1 CE 110: Homework #4 Digital Logic and Processor Data Path Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Friday, January 26, 1996. Assignments are
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-52.ps.Z, 19960125 Genetic Simulated Annealing and Application to Non-slicing Floorplan Design Seiichi Koakutsu Maggie Kang Wayne Wei-Ming Dai UCSC-CRL-95-52 November 18, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/protein/dirichlet/dirichlet.jnl.ps.Z, 19960126 Dirichlet Mixtures: A Method for Improving Detection of Weak but Significant Protein Sequence Homology Kimmen Sj olandery Computer Science U.C. Santa Cruz kimmen@cse.ucsc.edu Kevin Karplus Computer Engineering U.C. Santa Cruz karplus@cse.ucsc.edu Michael Brown Computer Science U.C. Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom5.ps, 19960126 CE 110: Homework #5 Building Control and High PerformanceJanuary 26, 1996 1 CE 110: Homework #5 Building Control and High Performance Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Monday, February 5, 1996. Assignments are
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/ifs_fractal_int.ps.Z, 19960126 IFS Fractal Interpolation for 2D and 3D Visualization1 Craig M. Wittenbrink Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/richard_final.ps, 19960130 1 Name: CE110 \| Computer Architecture Final Examination June 12, 1995 Closed Book. No calculators. Show all work. A blank sheet is included at the end of this exam. 1. 10% A 100-MHz (10 ns cycle time) machine has the following characteristics: Class A B C CPI 1 2 3 Frequency 0.4 0.3 0.3 (a) What is the
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-42.ps.Z, 19960131 Analysis of Source Policy in Rate-Controlled ATM Networks Lampros Kalampoukas Anujan Varma UCSC-CRL-95-42 January 31, 1996 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/spie96.rad.ps.gz, 19960131 Methods for Comparing 3D Surface Attributes Alex Pang and Adam Freeman Baskin Center for Computer Engineering & Information Sciences University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-54.ps.Z, 19960201 Dynamics of an Explicit Rate Allocation Algorithm for Available Bit-Rate (ABR) Service in ATM Networks Lampros Kalampoukas , Anujan Varma and K. K. Ramakrishnany UCSC-CRL-95-54 February 1, 1996 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 yAT&T Bell
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom6.ps, 19960206 CE 110: Homework #6 High Performance February 6, 1996 1 CE 110: Homework #6 High Performance Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Friday, February 9, 1996. Assignments are due at the beginning of class. Please put
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-10.ps.Z, 19960208 Distributed Algorithms for Multicast Path Setup in Data Networks Fred Bauer Anujan Varma UCSC-CRL-95-10 August 16, 1995 Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu/pub/tr/ucsc-crl-94-16.ps.Z, 19960208 Exponentiated Gradient Versus Gradient Descent for Linear Predictors Jyrki Kivinen Manfred K. Warmuth UCSC-CRL-94-16 June 21, 1994 Revised December 7, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-94-16.ps.Z, 19960208 Exponentiated Gradient Versus Gradient Descent for Linear Predictors Jyrki Kivinen Manfred K. Warmuth UCSC-CRL-94-16 June 21, 1994 Revised December 7, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-36.ps.Z, 19960208 ARIES: A Rearrangeable Inexpensive Edge-based On-line Steiner Algorithm Fred Bauer Anujan Varma UCSC-CRL-95-36 July 18, 1995 Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom7.ps, 19960212 CE 110: Homework #7 Memory, Cache, Virtual Memory February 11, 1996 1 CE 110: Homework #7 Memory, Cache, Virtual Memory Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Tuesday (Exchange Day), February 20, 1996. Assignments are
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-61.ps.Z, 19960214 Simultaneous Construction of Refutations and Models for Propositional Formulas Allen Van Gelder Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 UCSC-CRL-95-61 E-mail avg@cs.ucsc.edu. October 26, 1995
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-43.ps.Z, 19960214 An Experimental Comparison of New Property List Designs John Panzer and Linda Werner Dept. of Computer and Information Sciences University of California Santa Cruz Santa Cruz CA 95060 USA UCSC-CRL-95-43 December, 1995 panzer@cse.ucsc.edu and linda@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-41.ps.Z, 19960215 The Planar Pin Assignment and Routing Problem (PPARP) is NP-complete Joel Darnauer UCSC-CRL-95-41 August 1, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-33.ps.Z, 19960215 A Unified Approach to Evaluation Algorithms for Multivariate Polynomials Suresh Lodha Ron Goldman UCSC-CRL 95-33 July 23, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-46.ps.Z, 19960215 Visualizing Geometric Uncertainty of Surface Interpolants Suresh Lodha; lodha@cse.ucsc.edu Bob Sheehan; bob@cse.ucsc.edu Alex Pang; pang@cse.ucsc.edu Craig Wittenbrink; craig@cse.ucsc.edu UCSC-CRL 95-46 October 29, 1995 Baskin Center for Computer Engineering & Information Sciences University of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-03.ps.Z, 19960216 An Unexpected Factor in Testing for CMOS Opens: The Die Surface Haluk Konuk F. Joel Ferguson UCSC-CRL-96-03 January 10, 1996 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-05.ps.Z, 19960217 Carafe User's Manual Release Alpha.5 Alvin Jee David Dahle Cyrus Bazeghi F. Joel Ferguson UCSC-CRL-96-05 January 24, 1996 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 Copyright c Regents of the University of California
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom8.ps, 19960220 CE 110: Homework #8 Parallel Processing February 20, 1996 1 CE 110: Homework #8 Parallel Processing Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Monday, February 26, 1996. Assignments are due at the beginning of class.
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/vis_wdidv95-sv.ps.Z, 19960223 Realtime Database Support for Environmental Visualization Craig M. Wittenbrink, Eric Rosen, Alex Pang, Suresh K. Lodha, and Patrick Mantey Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom9.ps, 19960226 CE 110: Homework #9 Parallel Processing (MORE!) February 26, 1996 1 CE 110: Homework #9 Parallel Processing (MORE!) Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Monday, March 4, 1996. Assignments are due at the beginning of
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/peter.mmsj.ps.gz, 19960229 Multimedia Systems Manuscript-Nr. (will be inserted by hand later) Floor Control for Multimedia Conferencing and Collaboration Hans-Peter Dommel and J.J. Garcia-Luna-Aceves Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz, CA 95064, USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom10.ps, 19960301 CE 110: Homework #10 Parallel Programming and Abstractions (Last Assignment!)March 1, 1996 1 CE 110: Homework #10 Parallel Programming and Abstractions (Last Assignment!) Winter 1996 Instructor: Craig M. Wittenbrink Office: Applied Science Bldg. #309 Phone: (408) 459 4099 craig@cse.ucsc.edu Due: Monday,
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom8solns.ps, 19960306 CE 110: Homework #8 Solutions Parallel Processing March 6, 1996 3 9.6 Worst case latency is defined as the diameter of these trees. For 1024 nodes, the binary tree has levels, and therefore, the latency is twice this amount or links. . For the fat tree, assuming diameter with processors only as leaves
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom9solns.ps, 19960307 CE 110: Homework #9 Solutions Parallel Processing (MORE!)March 6, 1996 6 P9.D, Assume that some exotic new technology comes into being for implementing fast memories. The memories are the same cost as DRAMs, with a 4-fold order of magnitude increase in capacity and I/O bandwidth. Give me two different
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/final_rev_wtr_96.ps, 19960312 CE 110: Computer Architecture Review Overview March 11, 1996 2 hazard/performance techniques (forwarding, scoreboarding, register windows, etc.), superscalar/VLIW/superpipelined 7. Week of Feb 12, 14, 16: Completing the System (Ch. 7) HW #7 cache direct mapped, virtual memory, associativity 8. Week
	ftp://ftp.cse.ucsc.edu//pub/reinas/craig/ce110/hom10solns.ps, 19960312 CE 110: Homework #10 Solutions March 11, 1996 3 (2^j)-1) are those who execute the statement. The processors (n/(2^j)-1) to n-1 don t do anything. Now for n>P, do similar, but first partition into roughly n/P blocks A \| \| \| \| \| \| \| \| (not to scale) n/p n/p n/p n/p P0 P1 P2 . . . P(n-1) Add locally (and
	ftp://ftp.cse.ucsc.edu//pub/protein/dirichlet/techrep_96-09.ps.Z, 19960318 Dirichlet Mixtures: A Method for Improving Detection of Weak but Significant Protein Sequence Homology Kimmen Sj olandery Computer Science U.C. Santa Cruz kimmen@cse.ucsc.edu Kevin Karplus Computer Engineering U.C. Santa Cruz karplus@cse.ucsc.edu Michael Brown Computer Science U.C. Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/pats_report.ps.gz, 19960319 REINAS: Real-Time Environmental Information Network and Analysis System -- Annual Report 1995 University Research Initiative -- Office of Naval Research, No. N-00014-92-J-1807 Principal Investigator: Patrick E. Mantey, Ph.D. Jack Baskin Professor of Computer Engineering Address: Baskin Center for
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ATMForum95-1598.ps.Z, 19960322 CONTRIBUTION TO ATM FORUM PROJECT: Traffic Management Technical Working Group ATM Forum/95-1598 TITLE: Examination of the Effect of Rule 5 (Use-it-or-Lose-it) on TCP traffic SOURCE: University of California at Santa Cruz and AT&T Lampros Kalampoukas, Anujan Varma and K. K. Ramakrishnan E-mail:
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/BB96.ps.Z, 19960322 Dynamics of an Explicit Rate Allocation Algorithm for ATM Networks L. Kalampoukas, A. Varma Computer Engineering Department University of California, Santa Cruz, CA 95064, USA E-mail: flampros,varmag@cse.ucsc.edu K. K. Ramakrishnan AT&T Bell Laboratories, Murray Hill, NJ 07974, USA E-mail:
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ATMForum96-0230.ps.Z, 19960322 CONTRIBUTION TO ATM FORUM PROJECT: Traffic Management Technical Working Group ATM Forum/96-0230 TITLE: Another Examination of the Use-it-or-Lose-it Function on TCP Traffic SOURCE: University of California at Santa Cruz and AT&T Lampros Kalampoukas, Anujan Varma, K. K. Ramakrishnan and Kerry Fendick
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ICC96.ps.Z, 19960322 Analysis of Source Policy in Rate-Controlled ATM Networks Lampros Kalampoukas and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA, 96064 flampros, varmag@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/vis96.bump.ps.gz, 19960401 Directional Flow Visualization of 2D and 3D Vector Fields Ed Boring and Alex Pang Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/cut.ps.gz, 19960405 Cutting Planes and Beyond Michael Clifton and Alex Pang Computer Information Sciences Board University of California, Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-38.ps, 19960415 Latency-Rate Servers: A General Model for Analysis of Traffic Scheduling Algorithms Dimitrios Stiliadis Anujan Varma UCSC-CRL-95-38 July 18, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/amoeba/manuals/usr.ps.Z, 19960418 The Amoeba Reference Manual User Guide AMOEBA Amoeba is a registered trademark of the Vrije Universiteit in some countries. AMOEBA is a trademark of the Vrije Universiteit. Sun-3, Sun-4, NFS, SPARCclassic, SPARCstation, MicroSPARC, SunOS and Solaris" are trademarks of Sun Microsystems, Inc. SPARC is a
	ftp://ftp.cse.ucsc.edu//pub/amoeba/manuals/pro.ps.Z, 19960418 The Amoeba Reference Manual Programming Guide AMOEBA Amoeba is a registered trademark of the Vrije Universiteit in some countries. AMOEBA is a trademark of the Vrije Universiteit. Sun-3, Sun-4, NFS, SPARCclassic, SPARCstation, MicroSPARC, SunOS and Solaris" are trademarks of Sun Microsystems, Inc. SPARC
	ftp://ftp.cse.ucsc.edu//pub/amoeba/manuals/rel.ps.Z, 19960418 The Amoeba Reference Manual Release Information For Amoeba 5.3 AMOEBA Amoeba is a registered trademark of the Vrije Universiteit in some countries. AMOEBA is a trademark of the Vrije Universiteit. Sun-3, Sun-4, NFS, SPARCclassic, SPARCstation, MicroSPARC, SunOS and Solaris" are trademarks of Sun
	ftp://ftp.cse.ucsc.edu//pub/amoeba/Intro.ps.Z, 19960418 The Amoeba Distributed Operating System Andrew S. Tanenbaum & Gregory J. Sharp Vrije Universiteit De Boelelaan 1081a Amsterdam, The Netherlands Email: ast@cs.vu.nl, gregor@cs.vu.nl 1. INTRODUCTION Roughly speaking, we can divide the history of modern computing into the following eras: d 1970s:
	ftp://ftp.cse.ucsc.edu//pub/amoeba/manuals/sys.ps.Z, 19960418 The Amoeba Reference Manual System Administration Guide AMOEBA Amoeba is a registered trademark of the Vrije Universiteit in some countries. AMOEBA is a trademark of the Vrije Universiteit. Sun-3, Sun-4, NFS, SPARCclassic, SPARCstation, MicroSPARC, SunOS and Solaris" are trademarks of Sun Microsystems,
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-10.ps.Z, 19960426 Interchangeable Pin Routing with Application to Package Layout Man-Fai Yu Joel Darnauer Wayne Wei-Ming Dai UCSC-CRL-96-10 April 25, 1996 Baskin Center for Computer Engineering & Computer Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/protein/ismb96.poster.ps.gz, 19960427 Making hidden Markov models more biologically realistic: Improvements in remote homolog detection and alignment quality Melissa Cline and Kimmen Sj olander joint work with Christian Barrett, Marc Hansen, David Haussler, Richard Hughey, and Kevin Karplus Hidden Markov models have been successfully
	ftp://ftp.cse.ucsc.edu//pub/protein/dirichlet/cabios/paper.ps.gz, 19960604 Dirichlet Mixtures: A Method for Improved Detection of Weak but Significant Protein Sequence Homology Kimmen Sj olandery Computer Science U.C. Santa Cruz kimmen@cse.ucsc.edu Kevin Karplus Computer Engineering U.C. Santa Cruz karplus@cse.ucsc.edu Michael Brown Computer Science U.C. Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/wilhelms/proj.ps, 19960625 A Coherent Projection Approach for Direct Volume Rendering Jane Wilhelms and Allen Van Gelder Computer and Information Sciences University of California, Santa Cruz 95064
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/vis96.uflow.ps.gz, 19960708 UFLOW: Visualizing Uncertainty in Fluid Flow Suresh K. Lodha, Alex Pang, Robert E. Sheehan, and Craig M. Wittenbrink Computer Science Department University of California, Santa Cruz, CA 95064 flodha,pang,bob,craigg@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/vis96.directional.ps.gz, 19960709 Directional Flow Visualization of Vector Fields Ed Boring and Alex Pang Computer Science Department University of California, Santa Cruz, CA 95064 edb@cse.ucsc.edu, pang@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-04.ps.Z, 19960729 The Partial Rehabilitation of Propositional Resolution Allen Van Gelder Fumiaki Kamiya Baskin Center for Computer Engineering and Information Sciences University of California, Santa Cruz 95064 UCSC-CRL-96-04 E-mail avg@cs.ucsc.edu kamiya@cs.ucsc.edu. July 26, 1996
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-38.ps.Z, 19960730 Latency-Rate Servers: A General Model for Analysis of Traffic Scheduling Algorithms Dimitrios Stiliadis Anujan Varma UCSC-CRL-95-38 July 18, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-39.ps.Z, 19960730 Frame-based Fair Queueing: A New Traffic Scheduling Algorithm for Packet-Switched Networks Dimitrios Stiliadis Anujan Varma UCSC-CRL-95-39 July 18, 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-06.ps.Z, 19960730 UNIVERSITY OF CALIFORNIA SANTA CRUZ Using Phylogenetic Markov Trees to Detect Conserved Structure in RNA Multiple Alignments A thesis submitted in partial satisfaction of the requirements for the degree of MASTER OF SCIENCE in COMPUTER ENGINEERING by Bradford A. Gulko March 1995 The thesis of Bradford A
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-17.ps.Z, 19960731 Inferring Recursive Structures in Types in Prolog Programs using Abstract Interpretation Fumiaki Kamiya UCSC-CRL-96-17 July 25, 1996 Baskin Center for Computer Engineering & Computer Science University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-13.ps.Z, 19960731 Effect of Autarky Pruning on Random and Circuit Formulas: An Experimental Study Fumiaki Kamiya UCSC-CRL-96-13 June 30, 1996 Baskin Center for Computer Engineering & Computer Science University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-12.ps.Z, 19960731 A New Interactive Analog Layout Methodology based on Rubber-band Routing Kazuhiko Kobayashi Wayne Wei-Ming Dai UCSC-CRL-96-12 13 June 1996 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-08.ps.Z, 19960731 Maximum Likelihood Estimation for Failure Analysis of SRAM Cells Using Inductive Fault Analysis F.Joel Ferguson Jianlin Yu UCSC-CRL-96-08 March 5, 1996 Board of Studies in Computer Engineering University of California at Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/avg/voltx-tr-96-16.ps.Z, 19960802 Direct Volume Rendering with Shading via Three-Dimensional Textures Allen Van Gelder Kwansik Kim Baskin Center for Computer Engineering and Computer Science University of California Santa Cruz, CA 95064 USA E-mail: avg@cse.ucsc.edu, ksk@cse.ucsc.edu UCSC CRL 96 16 July 19, 1996
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-19.ps.Z, 19960805 1 A Finite-Source Multiserver Queue with Preemptive Priorities by Alexandre Brandwajn University of California Santa Cruz UCSC-CRL-96-19
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-16.ps.Z, 19960812 Direct Volume Rendering with Shading via Three-Dimensional Textures Allen Van Gelder Kwansik Kim Baskin Center for Computer Engineering and Computer Science University of California Santa Cruz, CA 95064 USA E-mail: avg@cse.ucsc.edu, ksk@cse.ucsc.edu UCSC CRL 96 16 July 19, 1996
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/seke96.ps.gz, 19960912 In Proceedings of 1996 Conference on Software Engineering and Knowledge Engineering, June 1996 / Page 1 REINAS: A Real-time System for Managing Environmental Datay Darrell D. E. Long, Patrick E. Mantey, Eric C. Rosen, Craig M. Wittenbrink Baskin Center for Computer Engineering & Computer Science
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/uncertainty.ps.gz, 19960913 Approaches to Uncertainty Visualization Alex T. Pang, Craig M. Wittenbrink , and Suresh K. Lodha Computer Science Department University of California Santa Cruz, CA 95064, USA Hewlett-Packard Laboratories 1501 Page Mill Road, Palo Alto, CA 94304, USA September 6, 1996
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-20.ps.Z, 19960916 1 Modelling and Analysis of a Transport Multicast Protocol Alexandre Brandwajn (1)1* and Serge Fdida (2) UCSC-CRL-96-20 (1) University of California, Santa Cruz, 225 Applied Science Building, Santa Cruz, California, Tel. +1 408 459 4023, alexb@ce.ucsc.edu (2) Laboratoire MASI-CNRS, Universit P.&M.
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/tryfonas_thesis.ps.Z, 19961001 University of California Santa Cruz MPEG-2 Transport over ATM Networks A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Engineering by Christos Tryfonas September 1996 The thesis of Christos Tryfonas is approved: Anujan Varma J.J.
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/fred_dissertation.ps.Z, 19961001 University of California Santa Cruz Multicast Routing in Point-to-Point Networks Under Constraints A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer Engineering by Fred Bauer Computer Engineering University of California, Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/dimitrios_dissertation.ps.Z, 19961002 University of California Santa Cruz Traffic Scheduling in Packet-Switched Networks: Analysis, Design, and Implementation A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer Engineering by Dimitrios Stiliadis June 1996 The dissertation
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-96-xx.ps.gz, 19961002 Two-Way TCP Traffic over ATM: Effects and Analysis Lampros Kalampoukas , Anujan Varma and K. K. Ramakrishnany UCSC-CRL-95- October 1, 1996 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 yAT&T Bell Laboratories Murray Hill, NJ 07974
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-58.ps.Z, 19961003 Rate-Proportional Servers: A Design Methodology for Fair Queueing Algorithms Dimitrios Stiliadis Anujan Varma UCSC-CRL-95-58 December 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-95-59.ps.Z, 19961003 Efficient Fair-Queueing Algorithms for ATM and Packet Networks Dimitrios Stiliadis Anujan Varma UCSC-CRL-95-59 December 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/lampros_thesis.ps.Z, 19961004 University of California Santa Cruz An Efficient Rate Allocation Algorithm for ATM Networks A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Engineering by Lampros Kalampoukas June 1995 The thesis of Lampros Kalampoukas is approved: Anujan
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/sigmetrics96.ps.Z, 19961007 Design and Analysis of Frame-based Fair Queueing: A New Traffic Scheduling Algorithm for Packet-Switched Networks Dimitrios Stiliadis and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/neural.ps.Z, 19961007 A Neural-Network Controller for Scheduling Packet Transmissions in a Crossbar Switch Anujan Varma and Robert Antonucci Computer Engineering Department University of California Santa Cruz, CA 95064 varma@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/infocom96.LR.ps.Z, 19961007 Latency-Rate Servers: A General Model for Analysis of Traffic Scheduling Algorithms Dimitrios Stiliadis and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/jsac96.ps.Z, 19961007 ARIES: A Rearrangeable Inexpensive Edge-based On-line Steiner Algorithm Fred Bauer Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064 August 10, 1995 This research is supported by the Advanced Research Projects Agency (ARPA) under Contract No. F19628-93-C-0175 and
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/swanet.ps.Z, 19961007 SWANET: A Novel Self-Routed Wavelength-Addressable Optical Switching Network1 A. Varma2, C. J. Chang-Hasnain3, K. Y. Lau4, J. W. Goodman3, M. S. Wu3, L. A. Buckman4, G. Giaretta3, and G. Jeong3
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/icc96.fast.ps.Z, 19961007 FAST: An FPGA-Based Simulation Testbed for ATM Networks Dimitrios Stiliadis and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/fc.ps.Z, 19961007 Fibre Channel and Related Standards Martin W. Sachs Anujan Varmay Apr. 8, 1996
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/api_vis_95.ps.gz, 19961008 Realtime Database Support for Environmental Visualization Craig M. Wittenbrink, Eric Rosen, Alex Pang, Suresh K. Lodha, and Patrick Mantey Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/nemesis/manual.ps, 19961023 The Nemesis User's Manual Craig Hall Brian Chess Tracy Larrabee Computer Engineering University of California, Santa Cruz 95064 1 Introduction Welcome to Nemesis. Nemesis is a diverse program that simulates and generates test patterns for circuits with a variety of different types of faults. Nemesis
	ftp://ftp.cse.ucsc.edu//pub/avg/AMAI/modoc0.ps.Z, 19961107 Simultaneous Construction of Refutations and Models for Propositional Formulas Allen Van Gelder University of California, Santa Cruz E-mail avg@cs.ucsc.edu. October 25, 1996
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/fred-jsac-96.ps.Z, 19961115 ARIES: A Rearrangeable Inexpensive Edge-based On-line Steiner Algorithm Fred Bauer Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064 August 10, 1995 This research is supported by the Advanced Research Projects Agency (ARPA) under Contract No. F19628-93-C-0175 and
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/fred-infocom-96.ps.Z, 19961115 ARIES: A Rearrangeable Inexpensive Edge-based On-line Steiner Algorithm Fred Bauer and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/fred-ton-96.ps.Z, 19961115 Distributed Algorithms for Multicast Path Setup in Data Networks Fred Bauer and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064 E-mail: ffred,varmag@cse.ucsc.edu Abstract Establishing a multicast tree in a point-to-point network of switch nodes, such as a
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/spie94.quality.ps.gz, 19961118 Data quality issues in visualization Alex Pang, Jeff Furman Computer and Information Sciences Board University of California, Santa Cruz, CA 95064 Wendell Nuss Department of Meteorology Naval Postgraduate School, Monterey, CA 93943
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/SuperCon97-1.ps.gz, 19961119 University of California, Santa Cruz Design of a Rate-Allocation Algorithm in an ATM Switch for Support of Available-Bit-Rate (ABR) Service Lampros Kalampoukas Anujan Varma Computer Engineering Department University of California Santa Cruz, CA, 95064 flampros,varmag@cse.ucsc.edu Design SuperCon'97
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/SuperCon97-3.ps.gz, 19961119 University of California, Santa Cruz Hardware Implementation of Fair-Queueing Algorithms in ATM and Packet Switches Dimitrios Stiliadis* Anujan Varma Computer Engineering Department University of California Santa Cruz, CA, 95064 fstiliadi,varmag@cse.ucsc.edu Design SuperCon'97 Currently with Lucent
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/SuperCon97-2.ps, 19961119 University of California, Santa Cruz A Reconfigurable Hardware Approach to Network Simulation Dimitrios Stiliadis* Anujan Varma Computer Engineering Department University of California Santa Cruz, CA, 95064 fstiliadi,varmag@cse.ucsc.edu Design SuperCon'97 Currently with Lucent Technologies Bell
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/tvcg_glyph.ps.gz, 19961120 Glyphs for Visualizing Uncertainty in Vector Fields Craig M. Wittenbrink, Alex T. Pang, and Suresh K. Lodha Baskin Center for Computer Engineering & Computer Science University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/tomacs.ps.Z, 19961124 NOTE: This is a preliminary release of an article accepted by the ACM Transactions on Modeling and Computer Simulation. The definitive version is currently in production at ACM and, when released, will supersede this version. Permission to make digital or hard copies of part or all of this work for
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/cga97.spray.ps.gz, 19961218 Spray Rendering Spray rendering is a framework for visualization which uses a spray paint can metaphor; cans are filled with smart particles (sparts) that are sprayed into the data to highlight interesting features. Features are displayed when sparts become activated and leave visualization objects
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/cga97.cspray.ps.gz, 19961218 CSpray Architecture CSpray uses a streams based architecture. Streams are a connection based communication abstraction implementable in Unix System V Streams or TCP/IP sockets. Streams are separated into priority, information and control streams. The streams handle a continuous flow of information
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/cga97.ps.gz, 19961218 Collaborative 3D Visualization with CSpray Alex Pang University of California, Santa Cruz Craig M. Wittenbrink Hewlett-Packard Laboratories
	ftp://ftp.cse.ucsc.edu//pub/ml/OHpaper.ps.Z, 19961230 Mutual Information, Metric Entropy, and Risk in Estimation of Probability Distributions David Haussler UC Santa Cruz Manfred Oppery Universit at W urzburg December 29, 1996 University of California Technical Report UCSC-CRL-96-27 Baskin Center for Computer Science and Computer Engineering UC Santa Cruz,
	ftp://ftp.cse.ucsc.edu//pub/ml/minimax.ps.Z, 19961230 A General Minimax Result for Relative Entropy David Haussler UC Santa Cruz December 29, 1996 University of California Technical Report UCSC-CRL-96-26 Baskin Center for Computer Science and Computer Engineering UC Santa Cruz, CA 96064
	ftp://ftp.cse.ucsc.edu//pub/ml/annals.ps.Z, 19961230 Mutual Information, Metric Entropy, and Cumulative Relative Entropy Risk David Haussler UC Santa Cruz Manfred Oppery Universit at W urzburg December 29, 1996 Submitted to Annals of Statistics Abbreviated title: Mutual Information and Risk AMS 1991 subject classifications: Primary 62G07; secondary 62B10,
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/Infocom97-2way.ps.Z, 19970130 Two-Way TCP Traffic over ATM: Effects and Analysis Lampros Kalampoukas and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA, 96064 flampros, varmag@cse.ucsc.edu K. K. Ramakrishnan AT&T Research Murray Hill, NJ 07974 kkrama@research.att.com
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/spie97.assim.ps.gz, 19970213 Visualization Tools for Data Assimilation Suzana Djurcilov and Alex Pang Computer Science Department University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/lodha/95.cagd.ps, 19970305 Change of Basis Algorithms for Surfaces in CAGD Suresh Lodha Department of Computer and Information Sciences University of California Santa Cruz, CA 95064 Ron Goldman Department of Computer Science Rice University Houston, TX 77251-1892
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-14.ps.Z, 19970319 Abstraction Level LowerHigherElectrical FaultsHigh-Level Faults Failure Mechanisms (Defects) Failure Modes (Geometric Faults) 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 Node 1Node
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-97-06.ps.Z, 19970327 Coping with Memory Latency Restructuring General-Purpose Programs to cope with Memory Latency Interim Project Report Dirk Coldewey UCSC-CRL-97-06 March 20, 1997 Board of Studies in Computer and Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-97-02.ps.Z, 19970327 1 REINAS: Real-Time Environmental Information Network and Analysis System: Phase V STATUS REPORT P.E. Mantey, D.D.E. Long,J.J. Garcia-Luna, G.G. Langdon, A.T. Pang, D.M. Fernandez, H.G. Kolsky, E.C. Rosen,C.M. Wittenbrink (UCSC), B.R. Gritton (MBARI), W.A. Nuss (NPS) UCSC-CRL-97-02 January 29, 1997
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-97-01.ps.Z, 19970327 On the Measured Equation of Invariance Weikai Sun, Wei Hong, and Wayne Wei-Ming Dai UCSC-CRL-97-01 January 15, 1997 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-97-03.ps.Z, 19970327 Timing-Driven Floorplanning with Intermediate Buffer Insertion Maggie Z.-W. Kang Wayne W.-M. Dai Tom Dillinger David LaPotin UCSC-CRL-97-03 February 14, 1997 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-18.ps.Z, 19970410 1 A MORE EFFICIENT DISTANCE VECTOR ROUTING ALGORITHM Zhengyu Xu Sa Dai J.J. Garcia-Luna-Aceves Computer Engineering Department University of California, Santa Cruz Santa Cruz, CA 95064, USA UCSC-CRL-96-18 March 1997
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-97-07.ps.Z, 19970428 Fast and Incremental Routability Check of A Topological Routing Using a Cut-based Encoding Man-Fai Yu Wayne Wei-Ming Dai UCSC-CRL-97-07 April 14, 1997 Baskin Center for Computer Engineering & Computer Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-97-08.ps.Z, 19970428 Delay Bounded Buffered Tree Construction for Timing Driven Floorplanning Maggie Z.-W. Kang and Wayne W.-M. Dai Tom Dillinger and David LaPotin UCSC-CRL-97-08 April 11, 1997 Baskin Center for Computer Engineering & Computer Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/karplus/casp-final.ps.gz, 19970429 Predicting protein structure using hidden Markov models Kevin Karplusy Computer Engineering U.C. Santa Cruz karplus@cse.ucsc.edu Kimmen Sj olander Computer Science U.C. Santa Cruz kimmen@cse.ucsc.edu Christian Barrett Computer Engineering U.C. Santa Cruz cbarrett@cse.ucsc.edu Melissa Cline Computer
	ftp://ftp.cse.ucsc.edu//pub/wilhelms/anatomy.ps.Z, 19970506 Anatomically Based Modeling Jane Wilhelms and Allen Van Gelder University of California, Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/lodha/cmwilson.thesis.ps.Z, 19970515 University of California Santa Cruz Listen: A data sonification toolkit A thesis submitted in partial satisfaction of the requirements for the degree of Master of Science in Computer Science by Catherine M. Wilson June 1996 The thesis of Catherine M. Wilson is approved: Suresh K. Lodha Darrell D.E. Long
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/sccg97.slug.ps.gz, 19970516 Integrated Visualization of Realtime Environmental Data Elijah Saxon, Zoe Wood, Michael O'Neil, Chris Oates, Jeremy Story, Suzana Djurcilov, and Alex Pang University of California, Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/Interop97-cam-ready.ps.Z, 19970526 Performance of Two-Way TCP Traffic over Asymmetric Access Links Lampros Kalampoukas and Anujan Varma Computer Engineering Department University of California Santa Cruz, CA, 96064 flampros, varmag@cse.ucsc.edu K. K. Ramakrishnan AT&T Research Murray Hill, NJ 07974 kkrama@research.att.com
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/sh2.alignment.ordered.ps, 19970529 SH2 domain alignment ordered to show subfamilies SRK3_SPOLA 1 ------------------------------------------------------- 55 SHC_HUMAN 1 -EPWFHGKLSRREAEALLQ--LN--GDFLVRESTTTPGQYVLTGLQSGQ-----P 55 FER_HUMAN 1 AEQWYHGAIPRIEAQELLK----KQGDFLVRESHGKPGEYVLSVYSDGQ-----R 55 VAV_HUMAN 1
	ftp://ftp.cse.ucsc.edu//pub/avg/fur_gi.ps.Z, 19970530 An Interactive Fur Modeling Technique Allen Van Gelder and Jane Wilhelms Computer Science Department University of California, Santa Cruz, U.S.A. 95064 E-mail: avg@cse.ucsc.edu, wilhelms@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/avg/fauna_tr_text.ps.Z, 19970531 Anatomically Based Modeling UCSC-CRL-97-10 Jane Wilhelms and Allen Van Gelder University of California, Santa Cruz April 15, 1997
	ftp://ftp.cse.ucsc.edu//pub/avg/fauna_tr_figs.ps.Z, 19970531 Figure 1: Anatomical components in the default resting posture. The skeleton is shown in white, the muscles in red, and the generalized tissue in purple. The skin with external features (eyes and nails) is shown in the lower right. 21 Figure 2: Typical default deformed-cylinder muscle, also illustrating
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/sh2.exp1.bete.tree.ps, 19970602 SRK3_SPOLA SHC_HUMAN VAV_HUMAN P85B_BOVIN P85A_BOVIN P85A_MOUSE P85A_HUMAN FER_HUMAN GTPA_HUMAN GTPA_BOVIN CRKL_HUMAN CRK_HUMAN CRK_CHICK GAGC_AVISC CSK_CHICK CSK_HUMAN CSK_RAT CSK_MOUSE CTK_HUMAN CTK_MOUSE CTK_RAT PIP4_BOVIN PIP4_RAT PIP4_HUMAN PIP5_RAT PIP5_HUMAN PTN6_MOUSE PTN6_HUMAN CSW_DROME
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/thesis.part1.ps.Z, 19970603 University of California Santa Cruz A Bayesian-Information Theoretic Method for Evolutionary Inference in Proteins A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Computer Science by Kimmen Sj olander Computer Science University of
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/thesis.part4.ps.Z, 19970603 124 Part IV Discussion and future work 125 9.8 Discussion of results Evolutionary tree inference methods compared in experiments reported here show a high degree of variability in tree topologies produced, for both single-gene and supergene families. Since these methods have for practical purposes been
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/thesis.part3.ps.Z, 19970603 67 Part III Experimental validation 68 9. Validation of tree topology estimation Almost without exception, experimental validation of evolutionary tree estimation methods has been done on simulated, not biological, data . Simulated data
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/thesis.part2.ps, 19970610 48 Part II Method 49 7. Evolutionary tree inference and subfamily identification 7.1 Overview The algorithm employed in this work to identify the functional subfamilies in a set of protein sequences can be decomposed into two subtasks: constructing an evolutionary tree, and cutting the tree into
	ftp://ftp.cse.ucsc.edu//pub/wilhelms/fauna_tr_text.ps.Z, 19970613 Anatomically Based Modeling UCSC-CRL-97-10 Jane Wilhelms and Allen Van Gelder University of California, Santa Cruz April 15, 1997
	ftp://ftp.cse.ucsc.edu//pub/wilhelms/fauna_tr_figs.ps.Z, 19970613 Figure 1: Anatomical components in the default resting posture. The skeleton is shown in white, the muscles in red, and the generalized tissue in purple. The skin with external features (eyes and nails) is shown in the lower right. 21 Figure 2: Typical default deformed-cylinder muscle, also illustrating
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-95-58.ps.Z, 19970714 Rate-Proportional Servers: A Design Methodology for Fair Queueing Algorithms Dimitrios Stiliadis Anujan Varma UCSC-CRL-95-58 December 1995 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr-ray.ps.gz, 19970718 Ray-based Data Level Comparisons of Direct Volume Rendering Algorithms Kwansik Kim and Alex Pang UCSC-CRL-97-15 July 18, 1997 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/wilhelms/spie.ps.Z, 19970718 Design decisions for a volume renderer user interface { some whys and hows Jane Wilhelms, Allen Van Gelder, Tom Goodman, Ronald MacCracken, Orion Wilson, Andy John Computer and Information Sciences, University of California, Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-97-16.ps.Z, 19970718 Projection-based Data Level Comparisons of Direct Volume Rendering Algorithms Kwansik Kim and Alex Pang UCSC-CRL-97-16 July 18, 1997 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-97-15.ps.Z, 19970718 Ray-based Data Level Comparisons of Direct Volume Rendering Algorithms Kwansik Kim and Alex Pang UCSC-CRL-97-15 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr-proj.ps.gz, 19970718 Projection-based Data Level Comparisons of Direct Volume Rendering Algorithms Kwansik Kim and Alex Pang UCSC-CRL-97-16 July 18, 1997 Baskin Center for Computer Engineering & Information Sciences University of California, Santa Cruz Santa Cruz, CA 95064 USA
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/computing.genome.era/1brd.sprot34.parsimony.tree1.ps, 19970813 Protein parsimony algorithm, version 3.54c +-----------------------------------NIR3_AZOBR ! +--BACT_NATPH -12 +----------------------------11 ! ! +--BACT_HALVA ! ! +--------BACH_HALSP +-10 +-----------------3 ! ! ! +-----BACH_HALSS ! ! +--4 ! ! ! +--BACH_NATPH ! ! +--5 +-----2 +--BACH_HALHM !
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/computing.genome.era/blosum62.ile.nonum.ps, 19970813 Expected amino acids using Substitution Matrix Blosum62 Given 1 Isoleucine Given 3 Isoleucines Given 10 Isoleucines A C D E F G H I K L M N P Q R S T V W Y
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/computing.genome.era/1brd.bete.tree.ps, 19970813 NIR3_AZOBR BACH_HALSPBACH_NATPH BACH_HALHM BACH_HALSS BACR_HALHP BACR_HALHS BACR_HALHA BACR_HALHM BAC1_HALS1 BAC2_HALS2 BACT_HALVA BACT_NATPH .10
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/computing.genome.era/dirichlet.ile.nonum.ps, 19970813 Expected amino acids using Dirichlet mixture prior Blocks9 Given 1 Isoleucine Given 3 Isoleucines Given 10 Isoleucines A C D E F G H I K L M N P Q R S T V W Y
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/computing.genome.era/1brd.sprot34.sfalign.part.ps, 19970813 Bacteriorhodopsin alignment BACH_HALSP 1 SSSLWVNVALAGIAILVFVYMGRTIRPRLIWGATLMIPLVSISSYLGLLSEMVRSQW 57 BACH_NATPH 1 ASSLYINIALAGLSILLFVFMTRGLRAKLIAVSTILVPVVSIASYTGLASDGVVTMW 57 BACH_HALHM 1 ---------IALAGLSILLFVYMGRRAQLIFVATLMVPLVSISSYTGLVSGGVFTPW 57 BACH_HALSS 1
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/computing.genome.era/paper-ucsc.ps, 19970813 BAYESIAN EVOLUTIONARY TREE ESTIMATION Kimmen Sj olander Pangea Systems, Inc. 1999 Harrison Street, Suite 1100 Oakland, CA 94612 kimmen@PangeaSystems.com FAX:(510)628-0108 August 13, 1997
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/computing.genome.era/9comp.plib.separate.ps, 19970813 Analysis of 9-Component Dirichlet Mixture Prior Blocks9 Comp. Ratio (r) of amino acid frequency relative to background frequency 8 <= r 4 <= r <= 8 2 <= r <= 4 1 <= r <= 2 1=2 <= r < 1 1=4 <= r < 1=2 1=8 <= r < 1=4 r < 1=8 1 SAT CGP NVM QHRIKFLDW EY 2 Y FW H LM NQICVSR TPAKDGE 3 QE KNRSHDTA MPYG VLIWCF
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-96-23.ps.Z, 19970829 Two-Way TCP Traffic over Rate Controlled Channels: Effects and Analysis Lampros Kalampoukas , Anujan Varma and K. K. Ramakrishnany UCSC-CRL-96-23 August 21, 1997 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 yAT&T Labs-Research Florham Park, NJ 07932
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/seke97.ps.gz, 19970917 REINAS: A Real-time System for Managing Environmental Data y Eric C. Rosen, Theodore R. Haining, Darrell D. E. Long, Patrick E. Mantey Baskin Center for Computer Engineering & Computer Science University of California Santa Cruz, CA Craig M. Wittenbrink Hewlett Packard Laboratories Palo Alto, CA
	ftp://ftp.cse.ucsc.edu//pub/jma/refguide-perl5.ps, 19970918 Perl Reference Guide for Perl version 5.000 Perl program designed and created by Larry Wall Reference guide designed and created by Johan Vromans identified items not in perl 4 with z. Contents 1. Command line options 2. Literals 3. Variables 4.
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/infocom97-sched.ps, 19971015 A General Methodology for Designing Efficient Traffic Scheduling and Shaping Algorithms Dimitrios Stiliadis Bell Laboratories Lucent Technologies Holmdel, NJ 07733 Anujan Varma Computer Engineering Department University of California Santa Cruz, CA 95064
	ftp://ftp.cse.ucsc.edu//pub/karplus/Prot-241D/paper.ps, 19971023 Predicting protein structure using hidden Markov models Kevin Karplusy Computer Engineering U.C. Santa Cruz karplus@cse.ucsc.edu Kimmen Sj olander Computer Science U.C. Santa Cruz kimmen@cse.ucsc.edu Christian Barrett Computer Engineering U.C. Santa Cruz cbarrett@cse.ucsc.edu Melissa Cline Computer
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p4.ps.Z, 19971109 V0V4V5V1V2V6V3V7ABCDEFG(a)(b)ray Figure 4: Simulation of polygon projection; (a) a cell with 8 vertices (V0 V7), (b) a volume cell is projected into 7 polygons (A to G) and a ray is intersected with polygon G. The blue vertices do not have any depth but the front and back color should be obtained. There
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p14.ps.Z, 19971109 (a) ff = :10 (b) ff = :15 (c) ff = :20 (d) ff = :30 Figure 10: DVR images with corresponding visualizations for the number of samples to reach the given opacity threshold. Regular ray sampling is used to render this Hipip data set. (a) 0.10, (b) 0.15, (c) 0.20, and (d) 0.30. Black regions indicate that
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/paper.ps.Z, 19971109 Ray-based Data Level Comparisons of Direct Volume Rendering Algorithms Kwansik Kim and Alex Pang Computer Science Department University of California, Santa Cruz, CA 95064 ksk@cse.ucsc.edu, pang@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p11.ps.Z, 19971109 ABCDE Figure 2: Fast Fourier transform of the corresponding images in Figure 1. For each input image, three separate FFTs are calculated, one for each red, green, blue color channels. These are then combined into a single color FFT image. Hence, brighter spots in an FFT image indicate larger magnitudes
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p15.ps.Z, 19971109 image 1 distances from eyes for image 1 dot product of red color (variation 1) correlation of blue color (variation 1) image 2 distances from eyes for image 2 dot product of opacities (variation 2) correlation of data (variation 2) Figure 12: Dot products and correlation metrics used to explain the
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p13.ps.Z, 19971109 Image level comparisons and its Fourier Transforms (a) : coherent projection vs ray based simulation of coherent projection (b) : ray based simulation vs raycasting with regular sampling (c) : raycasting with regular sampling vs coherent projection Figure 7: Image level analysis of images in gure 6. The
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/text.ps.Z, 19971109 Ray-based Data Level Comparisons of Direct Volume Rendering Algorithms Kwansik Kim and Alex Pang Computer Science Department University of California, Santa Cruz, CA 95064 ksk@cse.ucsc.edu, pang@cse.ucsc.edu
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p6.ps.Z, 19971109 below gives us an indication of the linear relationship or the dependencebetween the two random variables corresponding to two different rays. Since DVR algorithms assume continuity in the data volume and since we are focusing on regularly gridded data sets, it is fair to assume some degree of
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p17.ps.Z, 19971109 volume rendered imagesrendering 1rendering 2enlargements of highlighted arearendering 1rendering 2 Figure 14: Two images generated with two different rendering variations. The two image do not show signi cant differences except in the region highlighted by the square. The enlarged area of interest shows
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p10.ps.Z, 19971109 DE ABC Figure 1: Example of side-by-side image level comparisons (top row) and difference images (bottom row). The top row shows results from three different DVR algorithms: coherent projection (A), ray casting with regular sampling along the ray with trilinear interpolation (B), and ray casting with
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p18.ps.Z, 19971109 number of samplesvolume distancerendering 1rendering 2rendering 1rendering 2 Figure 15: Colormap and surface visualizations of number of samples and volume distance metrics for the rendered images in Figure 14. There is not much difference in volume distance, but there is signi cantly less number of
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p16.ps.Z, 19971109 (a) renderinged images of a partial CT Head data with a same algorithm(b) transfer functions for the two images (c) visualizations of volume distance metrics with opacity threshold 0.31 Figure 13: Tumor in skull data. Both images in (a) are rendered with ray tracing using regular sampling. However, they
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/dvr/p12.ps.Z, 19971109 (a) DVR images(b) distances(c) samples Figure 3: Data level comparison of ray tracing with cell face intersection algorithm on the top row and regular ray sampling on the bottom row. Left column (a) shows images from the two algorithms. The middle column (b) shows colormapped images of the distance from
	ftp://ftp.cse.ucsc.edu//pub/ml/Andrzejpaper.ps, 19971111 Metric Entropy and Minimax Risk in Classification David Haussler1 and Manfred Opper2 1 Computer Science, UC Santa Cruz, CA 95064, USA 2 Dept. of Physics, Universit at W urzburg, Germany
	ftp://ftp.cse.ucsc.edu//pub/ml/OHWCpaper.ps, 19971111 WORST CASE PREDICTION OVER SEQUENCES UNDER LOG LOSS MANFRED OPPER AND DAVID HAUSSLERy
	ftp://ftp.cse.ucsc.edu//pub/reinas/papers/cgi98.map.ps.Z, 19971113 Floating Ring: A New Tool for Visualizing Distortion in Map Projections Jeffrey Brainerd and Alex Pang Computer Science Department University of California, Santa Cruz, CA 95064 brainerd@cse.ucsc.edu, pang@cse.ucsc.edu We present a new method for interactive visualization of distortion in map
	ftp://ftp.cse.ucsc.edu//pub/avg/HP2cl/poly-res.ps, 19971116 Propositional Search with k-Clause Introduction Can be Polynomially Simulated by Resolution Allen Van Gelder University of California, Santa Cruz E-mail avg@cs.ucsc.edu. November 15, 1997
	ftp://ftp.cse.ucsc.edu//pub/protein/phylogeny/ismb-submission.ps.Z, 19980131 Phylogenetic inference in protein superfamilies: Analysis of SH2 domains Kimmen Sj olandery Molecular Applications Group kimmen@mag.com
	ftp://ftp.cse.ucsc.edu//pub/wilhelms/choices.ps, 19980202 Decisions in Volume Rendering Jane Wilhelms Computer and Information Sciences University of California, Santa Cruz 95064 1 1 Introduction There are a great range of possible choices to make in rendering volumetric data. The choices can make a difference in time and space requirements, ease of
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-97-23.ps.Z, 19980202 Topology Constrained Rectilinear Block Packing for Layout Reuse Technical Report : UCSC-CRL-97-23 Maggie Kang Wayne Dai maggiek@cse.ucsc.edu dai@cse.ucsc.edu Dept. of Computer Engineering University of California, Santa Cruz
	ftp://ftp.cse.ucsc.edu//pub/avg/JAR/aut.ps.Z, 19980202 Autarky Pruning in Propositional Model Elimination Reduces Failure Redundancy Allen Van Gelder University of California, Santa Cruz E-mail avg@cs.ucsc.edu. Oct. 25, 1996 Note: This paper was reviewed previously under the title, Simultaneous Construction of Refutations and Models for Propositional
	ftp://ftp.cse.ucsc.edu//pub/tr/ucsc-crl-96-33.ps.Z, 19980204 Time and Space Optimal Data Parallel Volume Rendering Using Permutation Warping1 Craig M. Wittenbrink Arun K. Somani Board of Computer Engineering, Dept. of Computer Science and University of California Engineering Santa Cruz, CA 95064 Dept. of Electrical Engineering, craig@cse.ucsc.edu University of
	ftp://ftp.cse.ucsc.edu//pub/hsnlab/ucsc-crl-97-21.ps.Z, 19980210 Explicit Window Adaptation: A Method to Enhance TCP Performance Lampros Kalampoukas , Anujan Varma and K. K. Ramakrishnany UCSC-CRL-97-21 August 21, 1997 Board of Studies in Computer Engineering University of California, Santa Cruz Santa Cruz, CA 95064 yAT&T Labs-Research Florham Park, NJ 07932